DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and Dkk2

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001099942.1 Gene:Dkk2 / 295445 RGDID:1308639 Length:259 Species:Rattus norvegicus


Alignment Length:223 Identity:52/223 - (23%)
Similarity:67/223 - (30%) Gaps:68/223 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SSPDNCRNG-FCRSP--GVCECFAEFVRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQET 172
            ||...|..| :|.||  |...|..  .|.:...| |...:.|...||. ||.|:        ..|
  Rat    79 SSDKECEVGRYCHSPHQGSSACMV--CRRKKKRC-HRDGMCCPGTRCN-NGICI--------PVT 131

  Fly   173 RQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIK 237
            .....|......||...       |.:.|:....|||.|.:..|..                  |
  Rat   132 ESILTPHIPALDGTRHR-------DRNHGHYSNHDLGWQNLGRPHS------------------K 171

  Fly   238 RPNWNVCEAECYL---NCENGLCESRYKCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVC 299
            .|:....|.:..|   :|.:|.|.:|:           ..|..|.|...    ||.       ||
  Rat   172 MPHIKGHEGDPCLRSSDCIDGFCCARH-----------FWTKICKPVLH----QGE-------VC 214

  Fly   300 RCFRGYEVHGAECRPKCESRFCGKYGRC 327
            ...|....||.|...:|:   |.|...|
  Rat   215 TKQRKKGSHGLEIFQRCD---CAKGLSC 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
Dkk2NP_001099942.1 Dickkopf_N 78..128 CDD:398399 17/52 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.