DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and Pear1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001128431.1 Gene:Pear1 / 295293 RGDID:1305653 Length:1033 Species:Rattus norvegicus


Alignment Length:322 Identity:85/322 - (26%)
Similarity:122/322 - (37%) Gaps:81/322 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 CCAGYRRDPYANECVPDCSASSPDNCRN-GFC-RSPGVCECFAEFVRNEHGACIHTCPIA----- 148
            |..|:    :...|..:|      .|.| |.| |..|.|.|...::.:.   |...||:.     
  Rat   261 CPEGF----HGPNCTQEC------RCHNGGLCDRFTGQCHCAPGYIGDR---CREECPVGRFGQD 312

  Fly   149 ------CQHG-RCY-LNGTCVCHQNFVLDQETRQFCRP-----KCSQSC---GTHEECVAP--GQ 195
                  |..| ||: .||.|:|...|..|:.|.:.|..     .|...|   ..|.....|  |:
  Rat   313 CAETCDCAPGARCFPANGACLCEHGFTGDRCTERLCPDGRYGLSCQDPCTCDPEHSLSCHPMHGE 377

  Fly   196 CDCSPGY----------RRTPDLGCQPVCAPDCGFGKCVAPN-QCECFAGFIKRPNWNVCEAECY 249
            |.|.||:          :.|...|||..|....| |.|:|.: .|.|..|:......|:|....|
  Rat   378 CSCQPGWAGLHCNESCPQDTHGAGCQEHCLCLHG-GVCLADSGLCRCAPGYTGPHCANLCPPNTY 441

  Fly   250 -LNCENGL-CESRYKCH-------CREGYRYDVNTTSCLP-----ECSDNCGQGN-GVCIAP--G 297
             :||.:.. ||:...|.       |:||::....:..|.|     .|:.:|...: ||| :|  |
  Rat   442 GINCSSHCSCENAIACSPVDGTCICKEGWQRGNCSVPCPPGTWGFSCNASCQCAHEGVC-SPQTG 505

  Fly   298 VCRCFRGYEVHGAECRPKCESRFCGKYGRCVAPEICGCGEGQQHCRNGSCDDIE-HCSCPSG 358
            .|.|..|:  .|..|:..|..   |::|...| .:|.|.      .:..||.:. ||.|.:|
  Rat   506 ACTCTPGW--RGVHCQLPCPK---GQFGEGCA-SVCDCD------HSDGCDPVHGHCRCQAG 555

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
Pear1NP_001128431.1 EMI 25..93 CDD:284877
EGF_CA 535..580 CDD:304395 8/27 (30%)
Laminin_EGF 620..665 CDD:278482
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.