DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and Megf10

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001094127.1 Gene:Megf10 / 291445 RGDID:735084 Length:1145 Species:Rattus norvegicus


Alignment Length:376 Identity:105/376 - (27%)
Similarity:136/376 - (36%) Gaps:133/376 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 CCAGYR---------RDPYANECVPDCSASSPDNCRN--GFCR-SPGVCECFAEFV--RNEHG-A 140
            |.||||         :..|.|:|...|...:...|.:  |.|| |||....|.|.:  ..:|| .
  Rat   169 CAAGYRGWRCEDRCEQGTYGNDCHQRCQCQNGATCDHITGECRCSPGYTGAFCEDLCPPGKHGPQ 233

  Fly   141 CIHTCPIACQHGR-C-YLNGTCVCHQNFVLDQETRQFCRPK------CSQSCGTHE--EC-VAPG 194
            |...||  ||:|. | ::.|.|.|...: :.....|.| |:      |||.|..|.  .| .|.|
  Rat   234 CEQRCP--CQNGGVCHHVTGECSCPSGW-MGTVCGQPC-PEGRFGKNCSQECQCHNGGACDAATG 294

  Fly   195 QCDCSPGY--RRTPD---LGCQPV-CAPDC---GFGKCV-APNQCECFAGF-------------- 235
            ||.|||||  .|..|   :|...| ||..|   ..|||. ....|.|.|||              
  Rat   295 QCHCSPGYTGERCQDECPVGTYGVRCAETCRCVNGGKCYHVSGTCLCEAGFSGEFCEARLCPEGL 359

  Fly   236 --IK------------------------RPNWN---------------VCEAECYLNCENGL-CE 258
              ||                        :|.|:               .|:..|  :|:||. |:
  Rat   360 YGIKCDKRCPCHLDNTHSCHPMSGECGCKPGWSGLYCNETCSPGFYGEACQQIC--SCQNGADCD 422

  Fly   259 S-RYKCHCREGY------------RYDVNTTSCLPECSDNCGQGNGVCIAP--GVCRCFRGYEVH 308
            | ..:|.|..|:            ||.:|       ||..||..|....:|  |.|.|..|:  |
  Rat   423 SVSGRCACAPGFKGTDCSTPCPLGRYGIN-------CSSRCGCKNDAVCSPVDGSCICKAGW--H 478

  Fly   309 GAECRPKCESRFCGKYGRCVAPEICGCGEGQQHCRNGSCDDIE-HCSCPSG 358
            |.:|...|.|   |.:|       .||....|....|:|:.:: .|:|..|
  Rat   479 GVDCSISCPS---GTWG-------FGCNLTCQCLNGGACNTLDGTCTCAPG 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
Megf10NP_001094127.1 EMI 32..99 CDD:400092
EGF_Lam 281..318 CDD:214543 15/36 (42%)
EGF_CA 542..587 CDD:419698
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.