DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and DKK2

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_055236.1 Gene:DKK2 / 27123 HGNCID:2892 Length:259 Species:Homo sapiens


Alignment Length:182 Identity:41/182 - (22%)
Similarity:57/182 - (31%) Gaps:48/182 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   111 SSPDNCRNG-FCRSP--GVCECFAEFVRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQET 172
            ||...|..| :|.||  |...|..  .|.:...| |...:.|...||. ||.|:        ..|
Human    79 SSDKECEVGRYCHSPHQGSSACMV--CRRKKKRC-HRDGMCCPSTRCN-NGICI--------PVT 131

  Fly   173 RQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAPDCGFG--------KCVAPNQC 229
            .....|......||...       |.:.|:....|||.|.:..|.....        .|:  ...
Human   132 ESILTPHIPALDGTRHR-------DRNHGHYSNHDLGWQNLGRPHTKMSHIKGHEGDPCL--RSS 187

  Fly   230 ECFAGF-IKRPNW-NVCEAECYLNCENGLCESRYK-----------CHCREG 268
            :|..|| ..|..| .:|:...:   :..:|..:.|           |.|.:|
Human   188 DCIEGFCCARHFWTKICKPVLH---QGEVCTKQRKKGSHGLEIFQRCDCAKG 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
DKK2NP_055236.1 Dickkopf_N 78..128 CDD:282549 17/52 (33%)
DKK-type Cys-1 78..127 17/51 (33%)
DKK-type Cys-2 183..256 12/59 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.