DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and DKK3

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001317149.1 Gene:DKK3 / 27122 HGNCID:2893 Length:364 Species:Homo sapiens


Alignment Length:312 Identity:67/312 - (21%)
Similarity:91/312 - (29%) Gaps:120/312 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 AGLTALLTLVAFP-----------VQIKTDSTVSTELYGDIENTEYGDFESLSQTRERQQHLCHR 61
            |.|..||...|.|           ..:|....:|   |...|.|....|..:.:..|..||....
Human     6 ATLLCLLLAAAVPTAPAPAPTATSAPVKPGPALS---YPQEEATLNEMFREVEELMEDTQHKLRS 67

  Fly    62 EV----------------------PSVFFQTERDSPVRGNGSTIYFHR----------------- 87
            .|                      ||...:|..|:.|..|  ||:.||                 
Human    68 AVEEMEAEEAAAKASSEVNLANLPPSYHNETNTDTKVGNN--TIHVHREIHKITNNQTGQMVFSE 130

  Fly    88 IEVCCAGYRRDPYANECV--PDCSASSPDNCRNGFCRSPGVCECFAEFVRNEHGACIHTC-PIAC 149
            ..:...|......::||:  .||..|.       :|:       ||.|.        :|| |...
Human   131 TVITSVGDEEGRRSHECIIDEDCGPSM-------YCQ-------FASFQ--------YTCQPCRG 173

  Fly   150 QHGRCYLNGTCVCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQ--- 211
            |...|..:..|...|..|....|:...|    .|.||    :...|.||.||      |.|.   
Human   174 QRMLCTRDSECCGDQLCVWGHCTKMATR----GSNGT----ICDNQRDCQPG------LCCAFQR 224

  Fly   212 ----PVCAPDCGFGK-CVAP------------------NQCECFAGFIKRPN 240
                |||.|....|: |..|                  ::|.|.:|.:.:|:
Human   225 GLLFPVCTPLPVEGELCHDPASRLLDLITWELEPDGALDRCPCASGLLCQPH 276



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.