DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and NimB2

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_723857.1 Gene:NimB2 / 260645 FlyBaseID:FBgn0028543 Length:421 Species:Drosophila melanogaster


Alignment Length:310 Identity:118/310 - (38%)
Similarity:161/310 - (51%) Gaps:27/310 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 LSQTRERQ-QHLCHREVPSV-FFQTERDSPVRGNGSTIYFHRIEVCCAGYRRDPYA-NECVPDCS 109
            :::||... ..:|::|||:. ..:..||..| |||:|....||:|||.||.|:|:. ..|.|.|:
  Fly   123 INKTRSAMASGVCYKEVPTASLLRNSRDQFV-GNGTTPDMSRIQVCCDGYERNPHIYRRCEPICA 186

  Fly   110 ASSPDNCRNGFCRSPGVCECFAEFVRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQETRQ 174
                |:||||.|.:|..|.|....||...|.||.|||:.|.:|.|.....|.|.:.:.|:.|||:
  Fly   187 ----DDCRNGICTAPNTCVCIPGHVRTAEGKCISTCPLGCGNGVCDERNECKCREGYSLEPETRK 247

  Fly   175 FCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRP 239
            :|:|:|...| :...||||.:|.|..|||...|..|:||| ..|..|||.||..|.|.||::|..
  Fly   248 YCQPECKPGC-SFGRCVAPNKCACLDGYRLAADGSCEPVC-DSCENGKCTAPGHCNCNAGYLKLQ 310

  Fly   240 NWNVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVCRCFRG 304
              ..||..|.:.|:||.|.....|.|..|:.:|..:..|||:|...|  .||||:....|.|..|
  Fly   311 --GRCEPICSIPCKNGRCIGPDICECASGFEWDRKSAECLPKCDLPC--LNGVCVGNNQCDCKTG 371

  Fly   305 Y--EVHGAE-CRPKCESRFCGKYGRCVAPEICGCG--------EGQQHCR 343
            |  :.|... |:|.| .:.| :.|.|.||..|.|.        :|:|.|:
  Fly   372 YVRDEHQRNICQPHC-PQGC-QNGYCSAPNFCICRPGFIKSGIKGRQTCQ 419



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469382
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I5147
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D16493at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24047
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.