DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and Dkk4

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_663567.1 Gene:Dkk4 / 234130 MGIID:2385299 Length:221 Species:Mus musculus


Alignment Length:217 Identity:54/217 - (24%)
Similarity:74/217 - (34%) Gaps:72/217 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   198 CSP---------GYRRTPDL---GCQPVCAP--DCGFGK-CVAPNQCECFAGFIKRPNWNVCE-- 245
            |||         ..:.:.|:   |...:||.  ||..|| |:|.:....|....:|.. ..|:  
Mouse    13 CSPLAALVLDFNNIKSSADVQGAGKGSLCASDRDCSEGKFCLAFHDERSFCATCRRVR-RRCQRS 76

  Fly   246 AECYLNCENGLCESRYKCHCREGYR--YDVNT----------TSCLP-------------ECSDN 285
            |.|   |...:|.:.. |...|..|  .|.||          |:..|             :...:
Mouse    77 AVC---CPGTVCVNDV-CTAVEDTRPVMDRNTDGQDGAYAEGTTKWPAEENRPQGKPSTKKSQSS 137

  Fly   286 CGQGNGVCI-----APGVCRCFRGYEVHGAECRPKC-ESRFCGKYGR---CVAPEI---CGCGEG 338
            .||....|:     .||:| |.|.:..  ..|:|.. |.:.|.:.|.   ..||||   |.||.|
Mouse   138 KGQEGESCLRTSDCGPGLC-CARHFWT--KICKPVLREGQVCSRRGHKDTAQAPEIFQRCDCGPG 199

  Fly   339 ----------QQHCRNGSCDDI 350
                      :||.|...|..|
Mouse   200 LTCRSQVTSNRQHSRLRVCQRI 221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
Dkk4NP_663567.1 Dickkopf_N 41..91 CDD:368068 15/54 (28%)
DKK-type Cys-1 41..90 15/53 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 101..143 7/41 (17%)
DKK-type Cys-2 145..218 22/75 (29%)
Prokineticin <145..202 CDD:148298 19/59 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.