DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and STAB1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_016861487.1 Gene:STAB1 / 23166 HGNCID:18628 Length:2615 Species:Homo sapiens


Alignment Length:318 Identity:79/318 - (24%)
Similarity:109/318 - (34%) Gaps:117/318 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 RIEV--CCAGYRRDPYANECVPDCS------ASSPDNCRNGFCRSPGVCECFAEFVRNEHGACIH 143
            :|:|  ||.|:    :...|.| |.      .|....|::.|..| |.|.|...|    ||....
Human  1314 KIQVPDCCPGF----FGTLCEP-CPGGLGGVCSGHGQCQDRFLGS-GECHCHEGF----HGTACE 1368

  Fly   144 TCPIA-----------CQHGRCYL----NGTCVCH---QNFVLDQETRQFCRPKCSQSCGTHEEC 190
            .|.:.           |.||.|..    :|:|||:   |....||   :...|:|.:.|..:..|
Human  1369 VCELGRYGPNCTGVCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQ---KITSPQCPRKCDPNANC 1430

  Fly   191 V----APGQCDCSPGYRRTPDLGCQPV--CAPDCGFGKC--------VAPNQ--CECFAGFIKRP 239
            |    ....|.|:.||... .:.|..|  ||.  |.|.|        |||.|  |.|..|::  .
Human  1431 VQDSAGASTCACAAGYSGN-GIFCSEVDPCAH--GHGGCSPHANCTKVAPGQRTCTCQDGYM--G 1490

  Fly   240 NWNVCE---------AECYLNCENGLC----ESRYKCHCREGYRYD-VNTTSCLPECSDNCGQGN 290
            :..:|:         ..|:::.|   |    ..:..|.|||||..| :.|...|..||.|    |
Human  1491 DGELCQEINSCLIHHGGCHIHAE---CIPTGPQQVSCSCREGYSGDGIRTCELLDPCSKN----N 1548

  Fly   291 GVCIAPGVCRCFRGYEVHGAECRPKCESRFCGKYGRCVAPEICGCGEGQQHCRNGSCD 348
            |.|.....|:                                 ..|:||:.|   :||
Human  1549 GGCSPYATCK---------------------------------STGDGQRTC---TCD 1570



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.