DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and Megf6

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001156449.1 Gene:Megf6 / 230971 MGIID:1919351 Length:1572 Species:Mus musculus


Alignment Length:430 Identity:110/430 - (25%)
Similarity:141/430 - (32%) Gaps:169/430 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 CCAGYRRDPYANEC---VP------DCSASSP-----DNCRNGFC--------RSPGVC------ 127
            |..|...||.:.||   .|      ||....|     .|| :|.|        |..|.|      
Mouse   703 CRPGVACDPVSGECRTQCPPGYQGEDCGQECPVGTFGVNC-SGSCSCVGAPCHRVTGECLCPPGK 766

  Fly   128 ---ECFAEFVRNEHG-ACIHTCPIACQHGRCY--LNGTCVCHQNFVLDQETRQFCRPKCSQ---- 182
               :|.|:......| .|...|| ||:||...  ..|||:|...||..:     |:..|..    
Mouse   767 TGEDCGADCPEGRWGLGCQEICP-ACEHGASCDPETGTCLCLPGFVGSR-----CQDACPAGWFG 825

  Fly   183 -------SCGTHEEC-VAPGQCDCSPGYRRTPDLGCQPVC-----APDC--------GFGKCVA- 225
                   :|.....| .|.|:|.|:||:   ..|.||..|     .|||        |.|.|.| 
Mouse   826 TGCQMRCACANDGHCHPATGRCSCAPGW---TGLSCQRACDSGHWGPDCIHPCNCSAGHGNCDAV 887

  Fly   226 PNQCECFAGFIKRP---NW-------NVCEAECYLNCENG----------LCESRYK-------- 262
            ...|.|.||: :.|   .|       ..||.:|  .||:|          .|.:.::        
Mouse   888 SGLCLCEAGY-EGPQCEQWCRQGYFGPGCEQKC--RCEHGATCDHVSGACTCPAGWRGSFCEHAC 949

  Fly   263 ------------CHCREGYRYDVNTTSCL-------PECSD---------NCGQ----GNGVCIA 295
                        |:|..|...|..|.||:       |.|:.         ||.|    .||....
Mouse   950 PAGFFGLDCGSACNCSAGAPCDAVTGSCICPAGRWGPHCAQTCPPLTFGLNCSQICTCFNGASCD 1014

  Fly   296 P--GVCRCFRGY-----------EVHGAECRPKCESRFCGK----YGRCVAPE---------ICG 334
            |  |.|.|..|:           .::|..|:..|..|..|.    .|:|..||         .|.
Mouse  1015 PVLGQCHCAPGWMGPTCLQACPAGLYGKNCQHSCLCRNGGNCDPILGQCTCPEGWTGLACENECL 1079

  Fly   335 CGEGQQHCR-------NGSCDDIE-HCSCPSGETHFIDRC 366
            .|.....||       .|:||.:. ||.||:|.|.  |:|
Mouse  1080 PGHHGAGCRLNCSCLNGGTCDRLTGHCRCPTGWTG--DKC 1117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
Megf6NP_001156449.1 EMI 42..111 CDD:284877
FXa_inhibition 126..161 CDD:291342
vWFA <153..201 CDD:294047
vWFA <236..284 CDD:294047
vWFA <283..324 CDD:294047
FXa_inhibition 337..372 CDD:291342
vWFA <370..409 CDD:294047
vWFA <412..451 CDD:294047
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.