Sequence 1: | NP_001260452.1 | Gene: | NimB1 / 34813 | FlyBaseID: | FBgn0027929 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_033424.1 | Gene: | Tnfaip6 / 21930 | MGIID: | 1195266 | Length: | 275 | Species: | Mus musculus |
Alignment Length: | 248 | Identity: | 48/248 - (19%) |
---|---|---|---|
Similarity: | 73/248 - (29%) | Gaps: | 112/248 - (45%) |
- Green bases have known domain annotations that are detailed below.
Fly 151 HGRCYLNGTCVCHQNFVLDQ-------------------ETRQFC-----------RPKCSQSCG 185
Fly 186 THEECVAPGQCDCSPGYRRTPDLGCQPVC--APDCGFGK-------------------CVAPNQC 229
Fly 230 ECFAGFI--KR-------PNWNVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTSCLPECSDN 285
Fly 286 CGQGNGVCIAPGVCRCFRGY-EVHGAECRPKCESRFCGKYGRCVAPEICGCGE 337 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
NimB1 | NP_001260452.1 | None | |||
Tnfaip6 | NP_033424.1 | Link_domain_TSG_6_like | 36..128 | CDD:239592 | 14/101 (14%) |
CUB | 135..244 | CDD:278839 | 24/117 (21%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 253..275 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |