Sequence 1: | NP_001260452.1 | Gene: | NimB1 / 34813 | FlyBaseID: | FBgn0027929 | Length: | 403 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_505091.1 | Gene: | sdz-23 / 186544 | WormBaseID: | WBGene00019066 | Length: | 267 | Species: | Caenorhabditis elegans |
Alignment Length: | 136 | Identity: | 25/136 - (18%) |
---|---|---|---|
Similarity: | 36/136 - (26%) | Gaps: | 69/136 - (50%) |
- Green bases have known domain annotations that are detailed below.
Fly 134 VRNEHGACIHTCPIACQHGRCYLNGTCVCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCDC 198
Fly 199 SPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKRPNWNVCEAECYLNCENGLCESRYKC 263
Fly 264 HCREGY 269 |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1218 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |