DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and C53B7.2

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_509154.2 Gene:C53B7.2 / 183744 WormBaseID:WBGene00016893 Length:169 Species:Caenorhabditis elegans


Alignment Length:217 Identity:48/217 - (22%)
Similarity:75/217 - (34%) Gaps:82/217 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 QFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAPDCGFGKCVAPNQCECFAGFIKR 238
            |:.:.....|||.:|:        .||         |..:|.|.|                  :.
 Worm    19 QYHQTTTQVSCGINEQ--------YSP---------CTQMCPPTC------------------ES 48

  Fly   239 PNWNVCEAECYLNCENGLCESRYKCHCREGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVCRCFR 303
            ||     .:|.::|      :|..|.|..|:.|. |:..|:|  :::|.|...:       ||..
 Worm    49 PN-----PQCRVDC------TRPSCTCLPGHVYS-NSRQCIP--ANSCYQTQSL-------RCRM 92

  Fly   304 GYEVHGAECRP--KCESRFCGK----YGRCV--APEICGCGEGQQHCRN---GSCDDIEHCS--- 354
                 ..:|||  .|.:.:||.    |.|.|  :..:.....|.:|..:   |.|....||.   
 Worm    93 -----NNDCRPGMYCINGYCGAASGVYTRTVVSSSSLSSSSSGHRHHSHRSQGECSLDVHCDHRK 152

  Fly   355 -CPSGETHFIDRCLKADRLSQH 375
             |..|      .|:.|||..::
 Worm   153 ICIDG------ICVYADRSDRY 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
C53B7.2NP_509154.2 TIL 29..82 CDD:366828 21/101 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.