DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and R08E3.1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_001338800.1 Gene:R08E3.1 / 180758 WormBaseID:WBGene00019957 Length:1943 Species:Caenorhabditis elegans


Alignment Length:232 Identity:51/232 - (21%)
Similarity:77/232 - (33%) Gaps:83/232 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    90 VCCAGYRRDPYANECVPDCSASSPDNCRNGFCRSPGVCECFAEFVRNEHGACIHTCPIACQHGRC 154
            :|......:.|.|..:.:.:||......:||.:. |.|.|.|::..|           :|...:|
 Worm    12 ICWRSAATEEYTNHWLTEDTASVQFCSHDGFLKD-GSCVCTADYNSN-----------SCLKRKC 64

  Fly   155 YLNGTCVCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLG--CQPV-CAP 216
                     :||..|           .||..:::    ..:|.|.||:     ||  |:|| |.|
 Worm    65 ---------RNFGFD-----------GQSFSSNK----VDRCICPPGF-----LGRNCEPVKCVP 100

  Fly   217 DCGFGKCVAPNQCECFAGFIKRPNWNVCEAECYLNCENGLCESRYKCHCREG------YRYD--- 272
              |..:..:.:..|.....:...|..:.|.....|..|..||       :||      |.||   
 Worm   101 --GSNQAYSSSNSEKSISLLASFNTKMAETWQTGNIGNLFCE-------KEGYWRSFNYNYDNAG 156

  Fly   273 ------VNTTSCLPECSD---------------NCGQ 288
                  .|||:|..:..|               .|||
 Worm   157 YTSSPSENTTTCTEKVQDYLTPDPCQNDYGNATTCGQ 193



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160166859
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.