DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and lag-2

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_503877.1 Gene:lag-2 / 178755 WormBaseID:WBGene00002246 Length:402 Species:Caenorhabditis elegans


Alignment Length:207 Identity:41/207 - (19%)
Similarity:61/207 - (29%) Gaps:63/207 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   155 YLNGTCVCHQNFVLDQET-----RQFCRPKCSQSCGTH------EECVAPGQCDCSPGYRRTPDL 208
            ::|.|........|...|     |.:...:|...|..|      :.|.|.|:..|..|:      
 Worm   103 WINDTFTTTSGISLSVATEVTCARNYFGNRCENFCDAHLAKAARKRCDAMGRLRCDIGW------ 161

  Fly   209 GCQPVCAPDCGFGKCVAPNQCECFAGFI--------KRPNWNVCEAECYLNCENGLCESRYKCHC 265
                 ..|.|  |:.|.|.:|.|....|        .:||......:....|.||...:|.:.. 
 Worm   162 -----MGPHC--GQAVDPRKCSCENDGICVSSMIHPSQPNQTSSNEQLICECTNGFTGTRCEIF- 218

  Fly   266 REGYRYDVNTTSCLPECSDNCGQGNGVCIAPGVCRCFRGYEVHGAECRPKCESRFCGKYGRCVAP 330
              |:. ....|:..|:          .|.....|       ::||:|.|.....||.        
 Worm   219 --GFN-QFQLTAPRPD----------ACSVKDAC-------LNGAKCFPNGPKVFCS-------- 255

  Fly   331 EICGCGEGQQHC 342
              |..|...:.|
 Worm   256 --CAVGFIGEFC 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
lag-2NP_503877.1 DSL 103..166 CDD:128366 14/73 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.