DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and abu-14

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_495966.2 Gene:abu-14 / 174464 WormBaseID:WBGene00004174 Length:373 Species:Caenorhabditis elegans


Alignment Length:357 Identity:78/357 - (21%)
Similarity:113/357 - (31%) Gaps:121/357 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 SQTRERQQHLCHREVPSVFFQTERDSPVRGNGSTIYFHRIEVCCAGYRRDPYANECVPDC--SAS 111
            ||..::.|..|:::             ..||...|...:...|          |:|...|  |.:
 Worm    76 SQCIQQCQPACNQQ-------------CGGNNQVILLPQTNNC----------NQCQQQCISSCA 117

  Fly   112 SP---DNCRNGFCRSPGVCECFAEFV------RNEHGACIHTCPIACQHGRCYLNGTCVC----- 162
            :|   .:|.|. |.|.  |...|..:      :|:.|:|..:|...|.        ||.|     
 Worm   118 TPICAQSCNNQ-CSSS--CGNSAPQIVVLQPQQNQCGSCQSSCQQTCP--------TCNCQSACA 171

  Fly   163 --------HQNFVL---DQETRQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAP 216
                    :|..::   |......|..:||.||.| ..|:...|..|....:.|    |||.|.|
 Worm   172 PACGGNNNNQQIIVVQQDNSCSSNCNNQCSSSCST-PICIQSCQSSCQQACQPT----CQPQCMP 231

  Fly   217 DCGFGKCV---AP--------NQCECFAGFIKRPNWNVCEAECYLNCENGLCESRYKCHCREGYR 270
            .|. ..|.   ||        :.|.           |.|..:|...|...:|..:....|:    
 Worm   232 SCS-SSCTSNQAPIVIVAQQGDSCS-----------NSCSNQCQSACPTPICVQQCNSQCQ---- 280

  Fly   271 YDVNTTSCLPECSDN-CGQGNGV-----------CIAPGVCRCFRGYEVHGAECRPKCE---SRF 320
                 :.|...||.| |.|...:           |.:..:..|.....|  .:|:|.|:   ...
 Worm   281 -----SQCSNSCSGNSCNQQQVIVLQQQDNCQNQCQSSCMNTCQSSATV--LQCQPICQQTCQNT 338

  Fly   321 CGKYGRCVAP-----EICGCGEGQQHCRNGSC 347
            |.:..:.|.|     ..|||..|...| .|||
 Worm   339 CQQAAQIVVPCQSSSSGCGCSSGYSQC-GGSC 369

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
abu-14NP_495966.2 OATP <178..261 CDD:332116 24/99 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG28772
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.