DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and Dkk3

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_612528.2 Gene:Dkk3 / 171548 RGDID:621846 Length:348 Species:Rattus norvegicus


Alignment Length:172 Identity:37/172 - (21%)
Similarity:54/172 - (31%) Gaps:47/172 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 KCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQP------VCAPDCGFGKCVAPNQC---ECFAG 234
            |.|..|...|:|.....|..| .::.|    |||      :|..|   .:|.....|   .|...
  Rat   142 KKSHECIIDEDCGPTRYCQFS-SFKYT----CQPCRDQQMLCTRD---SECCGDQLCAWGHCTQK 198

  Fly   235 FIKRPNWNVCEAECYLNCENGLCESRYK----------------CHCREGYRYDVNTTSCLPE-C 282
            ..|..|..:|:.:  .:|:.|||.:..:                ||.......|:.|....|| .
  Rat   199 ATKGSNGTICDNQ--RDCQPGLCCAFQRGLLFPVCTPLPVEGELCHDPTSQMLDLITWELEPEGA 261

  Fly   283 SDNCGQGNGVCIAPGVCRCFRGYEVHGAECRPKCESRFCGKY 324
            .|.|...:|:...|           |.......|:..|.|.:
  Rat   262 LDRCPCASGLLCQP-----------HSHSLVYMCKPAFVGSH 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
Dkk3NP_612528.2 Dickkopf_N 147..196 CDD:282549 13/56 (23%)
Prokineticin <208..273 CDD:148298 14/66 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.