DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and CCBE1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_016881045.1 Gene:CCBE1 / 147372 HGNCID:29426 Length:435 Species:Homo sapiens


Alignment Length:343 Identity:69/343 - (20%)
Similarity:106/343 - (30%) Gaps:120/343 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 ENTEYGDFESLSQTRERQQHLCHREVPSVFFQTERDSPVRGNGSTIYFHRIEVCCAGYRRDPYAN 102
            |..|.||.|..|:::               ..|.:...::.:|.....:| :.||.||:.  ...
Human    37 EEPEDGDREICSESK---------------IATTKYPCLKSSGELTTCYR-KKCCKGYKF--VLG 83

  Fly   103 ECVP---DCSASSP--DNCRNGFCRSPGVCECFA--EFVRNEHGA-----CIHTCPIACQHGRCY 155
            :|:|   |..|.:|  ..|.:.|.|.  :|.|:.  .:.|..|..     |:.....|..     
Human    84 QCIPEDYDVCAEAPCEQQCTDNFGRV--LCTCYPGYRYDRERHRKREKPYCLDIDECASS----- 141

  Fly   156 LNGTCVCHQNFVLDQETRQFCRPKCSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCA----- 215
             |||               .|...|..:.|::       :|:|..||.|..|   ...|.     
Human   142 -NGT---------------LCAHICINTLGSY-------RCECREGYIREDD---GKTCTRGDKY 180

  Fly   216 -PDCGF---------GKCVAPNQCECFAGF------IKR-----PNWNVCEAECYLNCENGLCES 259
             .|.|.         |.|.|  .|:.|...      :|:     || |..:...|:..:..|..:
Human   181 PNDTGHEKSENMVKAGTCCA--TCKEFYQMKQTVLQLKQKIALLPN-NAADLGKYITGDKVLASN 242

  Fly   260 RY-------------KCHCREGYRYDVNTTSCLPECSDNCGQGNGVCI---------------AP 296
            .|             ...|..|:|..:.....||:.....|..|.:.:               |.
Human   243 TYLPGPPGLPGGQGPPGECGRGHRRVITNRKSLPKAHICWGLDNVLQLPSRRNKAHQDQREAQAS 307

  Fly   297 GVCRCFRGYEVHGAECRP 314
            .||:...|...|||:..|
Human   308 PVCQALLGSPAHGAQWDP 325



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.