DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and Dkk1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:NP_034181.2 Gene:Dkk1 / 13380 MGIID:1329040 Length:272 Species:Mus musculus


Alignment Length:203 Identity:50/203 - (24%)
Similarity:71/203 - (34%) Gaps:63/203 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   191 VAPGQCDCSPGYRRTPDLGCQPV-CAPD--CGFGK-CVAPNQCECFAGFIKRPNWNVCEA----- 246
            ||||.........:|.| ..||. ||.|  ||..: |.:|::.....|.::     :|.|     
Mouse    63 VAPGVLYEGGNKYQTLD-NYQPYPCAEDEECGSDEYCSSPSRGAAGVGGVQ-----ICLACRKRR 121

  Fly   247 -ECYLN--------CENGLCESRYKCH---------------------CREGYRYDVNTTSCLPE 281
             .|..:        |:||:|......|                     ..:||......||.:..
Mouse   122 KRCMRHAMCCPGNYCKNGICMPSDHSHFPRGEIEESIIENLGNDHNAAAGDGYPRRTTLTSKIYH 186

  Fly   282 CSDNCGQGNGVCI-----APGVCRCFRGYEVHGAECRPKC-ESRFCGKYGRCVAPEI-----CGC 335
            ..   ||...||:     |.|:| |.|.:  ....|:|.. |.:.|.|:.|..:..:     |.|
Mouse   187 TK---GQEGSVCLRSSDCAAGLC-CARHF--WSKICKPVLKEGQVCTKHKRKGSHGLEIFQRCYC 245

  Fly   336 GEGQQHCR 343
            |||.. ||
Mouse   246 GEGLA-CR 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
Dkk1NP_034181.2 Dickkopf_N 86..142 CDD:282549 14/60 (23%)
DKK-type Cys-1 86..141 14/59 (24%)
DKK-type Cys-2 195..269 19/62 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1218
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.