DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment NimB1 and pear1

DIOPT Version :9

Sequence 1:NP_001260452.1 Gene:NimB1 / 34813 FlyBaseID:FBgn0027929 Length:403 Species:Drosophila melanogaster
Sequence 2:XP_017952446.2 Gene:pear1 / 100489801 XenbaseID:XB-GENE-6045593 Length:1087 Species:Xenopus tropicalis


Alignment Length:392 Identity:105/392 - (26%)
Similarity:136/392 - (34%) Gaps:146/392 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    82 TIYFHRIEV-------CCAGYRRDPYANE-CVPDCSASSPDNCRNGFCRSPGVCECFAEFVRNEH 138
            |.|.||:::       ||.||..   :|: |||.|:    ..|.:|.|.:|..|:|       |.
 Frog    76 TAYRHRVKLDYRRRYWCCKGYYE---SNDICVPRCT----QECVHGRCIAPDQCQC-------EP 126

  Fly   139 G-----------------ACIHTCPIACQ-HGRC-YLNGTCVCHQNFVLDQETRQFCRP-----K 179
            |                 .|..|||  || :|.| ..:|||:|...| .|....:.|.|     .
 Frog   127 GWRGKDCSSACEAHVWGPKCNSTCP--CQNNGACDAASGTCICPPGF-RDPFCEKPCDPGTYGGG 188

  Fly   180 CSQSCGTHEECVAPGQCDCSPGYRRTPDLGCQPVCAPDCGFGKCVAP------NQCECFAGFIKR 238
            ||.||    :|....:||...|....|:....|.|...|   |.|.|      :||.|.:|.|..
 Frog   189 CSLSC----QCKNGAECDPENGACLCPEGYTGPYCEIRC---KEVQPANFSCSDQCLCQSGGICN 246

  Fly   239 ---------PNW---------------NVCEAECYLNCEN-GLCESRY-KCHCREGYRYDVNTTS 277
                     |.|               ..|:.||.  |.| |.|:.:. :|.|.|||..|.....
 Frog   247 QSSGECSCPPGWMGSLCSIPCPDGYYGRNCKQECL--CHNGGQCDPKTGQCLCSEGYTGDHCREE 309

  Fly   278 CLP------ECSDNCGQGNGV-CI-APGVCRCFRGYEVHGAECRPKCESRFC--GKYG-----RC 327
            | |      :||:.|...|.| |. ..|.|.|..|::...      |:.|.|  |.||     ||
 Frog   310 C-PIGKYGKDCSEKCDCINAVRCYHINGGCLCEHGFKGEA------CDERMCPPGLYGMPCNLRC 367

  Fly   328 VAPEI-----------CGCGEG-------------------QQHC---RNGSCD-DIEHCSCPSG 358
            :...:           |.|..|                   |:.|   ..|||| :...|.|..|
 Frog   368 LCDPLHSQSCHPMSGECACKPGWSGLYCNETCPHGYYGTNCQELCVCLNGGSCDSETGECICAPG 432

  Fly   359 ET 360
            .|
 Frog   433 FT 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NimB1NP_001260452.1 None
pear1XP_017952446.2 EMI 29..97 CDD:400092 7/20 (35%)
exchanger_TraA <147..>310 CDD:411343 50/174 (29%)
exchanger_TraA <416..729 CDD:411343 8/19 (42%)
Laminin_EGF 546..586 CDD:395007
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.