DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk3 and nahoda

DIOPT Version :9

Sequence 1:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_523815.2 Gene:nahoda / 37641 FlyBaseID:FBgn0034797 Length:1335 Species:Drosophila melanogaster


Alignment Length:101 Identity:25/101 - (24%)
Similarity:32/101 - (31%) Gaps:4/101 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 TITITKGIPVPVHVDRPYPVVHEKRVPVEVKVPVP--QPYEVIRKVPVTVKEYVKVPVPVPQPYE 179
            |.|:...:|.|.....|......|..|.....|.|  :|.......|.:..|....|.|..:|..
  Fly   314 TTTLEASVPEPKSEPEPKSEPEPKSEPEPKSEPEPKSEPEPKSEPEPKSEPEPKSEPEPKSEPEP 378

  Fly   180 VIRHEKVPVHVPVDRPVPVEVPRP--YPVPVAKPYP 213
            ....|......|...|.|...|.|  .|.|.::|.|
  Fly   379 KSEPEPKSEPEPKSEPEPKSEPEPKSEPEPKSEPEP 414

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk3NP_609690.1 None
nahodaNP_523815.2 Chitin_bind_3 36..162 CDD:281112
EGF_2 202..238 CDD:285248
DOMON_like 255..>297 CDD:301346
DOMON_DOH <593..693 CDD:187689
DOMON 765..884 CDD:281361
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45454995
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.