DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk3 and CG13138

DIOPT Version :9

Sequence 1:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster


Alignment Length:174 Identity:58/174 - (33%)
Similarity:81/174 - (46%) Gaps:53/174 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VVHE----------KRVPVEVK---------------VPVPQPYEVIRKVPVTVKEYVKVPVPVP 175
            ::||          ||:.|::|               ..|||||.|.:.|.|.:::.|:..|.||
  Fly   149 ILHEHVEHSSKKDAKRMKVKIKHHHHHHHHNHIKELIKTVPQPYPVEKVVHVPIEKIVEKIVHVP 213

  Fly   176 QPYEVIRHEKVPVHVPVDR--------PVPVEVPRPYPVP--------VAKPYPVY--VEKAVNV 222
            :...| ..||: ||||:::        |.||:||:||.|.        |.|||||.  |...|.:
  Fly   214 KLVNV-TVEKI-VHVPIEKIVEKVIHIPKPVQVPKPYVVEKIIEKIVHVPKPYPVLRTVPYPVEI 276

  Fly   223 QVPVHVDR----PYPVYV--KVPVV--SHSVVKHAPTVAVSSYP 258
            :||||:::    ||.|.|  ||||.  |....|...:....|||
  Fly   277 KVPVHLEKKVPVPYKVEVERKVPVYIRSSEPYKFESSSLYESYP 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk3NP_609690.1 None
CG13138NP_609372.1 IMCp 188..279 CDD:289112 35/92 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.