DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk3 and Zfp512

DIOPT Version :9

Sequence 1:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_006239896.1 Gene:Zfp512 / 313906 RGDID:1561526 Length:562 Species:Rattus norvegicus


Alignment Length:107 Identity:26/107 - (24%)
Similarity:43/107 - (40%) Gaps:30/107 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VAVH----HAPAPYVISKQADVHKTITI-TKG----------IPV-------PVHVDRPYP--VV 137
            :|.|    |.|..:..|.|.|..|.::: |||          |.|       .|.:.:.:|  .|
  Rat   305 LAYHMRSEHGPVFFPESGQPDCLKEMSLETKGGGRVQRRSAKIAVYHLQELASVELTKEWPKRKV 369

  Fly   138 HEKRVPVEVKVPVPQP------YEVIRKVPVTVKEYVKVPVP 173
            .:..||.:.|:...:|      .||:.|....:|:|.::..|
  Rat   370 LQDLVPDDRKLKYTRPGLPTFSQEVLHKWKTDIKKYHRIQCP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk3NP_609690.1 None
Zfp512XP_006239896.1 SFP1 <409..465 CDD:227516 1/3 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166344544
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.