DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk3 and CG33299

DIOPT Version :9

Sequence 1:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_995671.2 Gene:CG33299 / 2768912 FlyBaseID:FBgn0053299 Length:193 Species:Drosophila melanogaster


Alignment Length:256 Identity:74/256 - (28%)
Similarity:102/256 - (39%) Gaps:104/256 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 KVFICLAALLVASACASKTEGEKVPLEKKLDKRGLLDLGYGYGHAGLDTGYLGHGSISGHGSYGH 66
            ::.||...|:    |||:..||                |||.|:     ||.|.|. .|.||.|.
  Fly    25 QLLICSIQLI----CASEHSGE----------------GYGDGY-----GYGGSGG-GGSGSLGS 63

  Fly    67 GYGLTGYSAPAAVAVGHSGPAIAVGHTAPAVAVHHAPAPY-VISKQADVHKTITITKGIPVPVHV 130
            |.|..|:.                 |       ||.|..| .|||...||    :.:.:|:|:  
  Fly    64 GGGGDGHF-----------------H-------HHTPTTYSEISKHVPVH----VIEKVPLPI-- 98

  Fly   131 DRPYPVVHEKRVPVEVKVPVPQPYEVIRKVPVTVKEYVKVPVPVPQPYEVIRHEKVPVHVPV--- 192
              |:||.  .:||..:::.:|:||              .|.|||.|          .:||||   
  Fly    99 --PHPVA--VQVPNVIRLQIPEPY--------------AVHVPVQQ----------EIHVPVYKI 135

  Fly   193 -----DRPVPVEVPRPYPVPVAKPYPVYVEKAVNVQVPVHVDRPYPVYVKVPVVSHSVVKH 248
                 ::.:|..|.:||||.|.|||||.|.|.:.:.||    :|||       |..::.||
  Fly   136 VPEITEKKIPYTVEKPYPVEVEKPYPVEVIKQIKIPVP----KPYP-------VPFTIYKH 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk3NP_609690.1 None
CG33299NP_995671.2 predic_Ig_block 123..>184 CDD:275319 27/81 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.