DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk3 and Zfp512

DIOPT Version :10

Sequence 1:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_766581.2 Gene:Zfp512 / 269639 MGIID:1917345 Length:562 Species:Mus musculus


Alignment Length:108 Identity:25/108 - (23%)
Similarity:41/108 - (37%) Gaps:32/108 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VAVH----HAPAPYVISKQADVHKTITI-TKG----------IPVPVHVDR----------PYPV 136
            :|.|    |.|..:..|:|.|..|.::: .||          |.| .|:..          |...
Mouse   305 LAYHMRSEHGPVFFPESEQPDCLKEMSLEAKGGGRVQRRSAKIAV-YHLQELASAELTKEWPKRK 368

  Fly   137 VHEKRVPVEVKVPVPQP------YEVIRKVPVTVKEYVKVPVP 173
            |.:..||.:.|:...:|      .||:.|....:|:|.::..|
Mouse   369 VLQDLVPDDRKLKYTRPGLPTFSQEVLHKWKTDIKKYHRIQCP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk3NP_609690.1 None
Zfp512NP_766581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..150
SFP1 <409..465 CDD:227516 1/3 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..562
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.