DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk3 and Zfp512

DIOPT Version :9

Sequence 1:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_766581.2 Gene:Zfp512 / 269639 MGIID:1917345 Length:562 Species:Mus musculus


Alignment Length:108 Identity:25/108 - (23%)
Similarity:41/108 - (37%) Gaps:32/108 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    97 VAVH----HAPAPYVISKQADVHKTITI-TKG----------IPVPVHVDR----------PYPV 136
            :|.|    |.|..:..|:|.|..|.::: .||          |.| .|:..          |...
Mouse   305 LAYHMRSEHGPVFFPESEQPDCLKEMSLEAKGGGRVQRRSAKIAV-YHLQELASAELTKEWPKRK 368

  Fly   137 VHEKRVPVEVKVPVPQP------YEVIRKVPVTVKEYVKVPVP 173
            |.:..||.:.|:...:|      .||:.|....:|:|.::..|
Mouse   369 VLQDLVPDDRKLKYTRPGLPTFSQEVLHKWKTDIKKYHRIQCP 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk3NP_609690.1 None
Zfp512NP_766581.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..32
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..150
AdoMet_MTases <269..355 CDD:302624 13/50 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 489..562
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841136
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.