DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk3 and Zfp512b

DIOPT Version :9

Sequence 1:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster
Sequence 2:NP_001158069.1 Gene:Zfp512b / 269401 MGIID:2685478 Length:869 Species:Mus musculus


Alignment Length:253 Identity:67/253 - (26%)
Similarity:102/253 - (40%) Gaps:47/253 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 SACASKTEGEKVPLEKKLDKRGLLDLGYGYGHAGLDTGYLGHGSISGHGS-----YGHGYGL--- 70
            ::.:.||||:|.. ..|.:.:.|.|:.....:...|. :..|..:....|     :...|||   
Mouse    64 NSASDKTEGKKKG-RPKAENQALRDIPLSLMNQWKDE-FKAHSRVKCPNSGCWLEFPSIYGLKYH 126

  Fly    71 ------------TGYSAPAAVAVGHSGPAIA-------VGHTAPAVAVHHAPAPYVISKQADVHK 116
                        ..:..|...|...|...:.       :.|..||........|..||:...|.|
Mouse   127 YQRCQGGAISDRLAFPCPFCEAAFTSKTQLEKHRIWNHMDHPLPAPKPGPVSRPVTISRPVGVSK 191

  Fly   117 TITITKGIPV--PVHVDRPY----PVVHEKRVPVEVKVPVPQPYEVIRKVPVTVKEYVKVPVPVP 175
            .|.::|.:.|  ||.|.:|.    ||...:.:||...|.|.:|.:|.|.||||      .|:|:.
Mouse   192 PIGVSKPVTVGKPVGVSKPIGISKPVTVSRPIPVTKPVTVSRPMQVSRPVPVT------KPIPIT 250

  Fly   176 QPYEVIRHEKVPVHVPVDRPVPVEVPRPYPVPVAKPYPVYVEKAVNVQVPVHVDRPYP 233
            :|..:.:|..|...|.|.:|||:    ..||||::  |:.|.|.|.|..|:.:.|..|
Mouse   251 KPVPLTKHMPVTKLVTVSKPVPL----TKPVPVSR--PIVVSKPVPVSRPIAISRHIP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk3NP_609690.1 None
Zfp512bNP_001158069.1 PRK12323 <170..425 CDD:237057 49/145 (34%)
C2H2 Zn finger 573..594 CDD:275368
C2H2 Zn finger 609..630 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841129
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E33208_3BHSB
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.