DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk3 and znf512

DIOPT Version :9

Sequence 1:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster
Sequence 2:XP_005160899.1 Gene:znf512 / 101882368 ZFINID:ZDB-GENE-041014-346 Length:656 Species:Danio rerio


Alignment Length:43 Identity:13/43 - (30%)
Similarity:18/43 - (41%) Gaps:9/43 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   157 IRKVPVTVKEYVKVPVPVPQ---------PYEVIRHEKVPVHV 190
            ::|....||:.|.|.|||.|         ..:..:|.|...||
Zfish   165 LKKYIEQVKQTVPVIVPVAQFSQKTQRTEEQKSAQHNKKETHV 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk3NP_609690.1 None
znf512XP_005160899.1 SFP1 <224..368 CDD:227516
SFP1 <392..519 CDD:227516
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170585613
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.