powered by:
Protein Alignment Vajk3 and znf512
DIOPT Version :9
Sequence 1: | NP_609690.1 |
Gene: | Vajk3 / 34812 |
FlyBaseID: | FBgn0028544 |
Length: | 277 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005160899.1 |
Gene: | znf512 / 101882368 |
ZFINID: | ZDB-GENE-041014-346 |
Length: | 656 |
Species: | Danio rerio |
Alignment Length: | 43 |
Identity: | 13/43 - (30%) |
Similarity: | 18/43 - (41%) |
Gaps: | 9/43 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 157 IRKVPVTVKEYVKVPVPVPQ---------PYEVIRHEKVPVHV 190
::|....||:.|.|.|||.| ..:..:|.|...||
Zfish 165 LKKYIEQVKQTVPVIVPVAQFSQKTQRTEEQKSAQHNKKETHV 207
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Vajk3 | NP_609690.1 |
None |
znf512 | XP_005160899.1 |
SFP1 |
<224..368 |
CDD:227516 |
|
SFP1 |
<392..519 |
CDD:227516 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170585613 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.