DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk1 and Vajk3

DIOPT Version :9

Sequence 1:NP_609688.3 Gene:Vajk1 / 34809 FlyBaseID:FBgn0028938 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_609690.1 Gene:Vajk3 / 34812 FlyBaseID:FBgn0028544 Length:277 Species:Drosophila melanogaster


Alignment Length:193 Identity:86/193 - (44%)
Similarity:101/193 - (52%) Gaps:42/193 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 HHVP-------HFPVHEEKTLTVIKKVPVPVPIEKIVHVPVEKHIHVPVKVKVPKPYPVIKHIPY 125
            ||.|       ...||  ||:|:.|.:||||.:::...|..||.:.|.|||.||:||.||:.:|.
  Fly   100 HHAPAPYVISKQADVH--KTITITKGIPVPVHVDRPYPVVHEKRVPVEVKVPVPQPYEVIRKVPV 162

  Fly   126 EVKEIVKVPYEVPAPYPVEKQVHVPVHVHYDRPVPVKVHVPAPYPVEKKVHVPVKVHVPAPYP-- 188
            .|||.||||..||.||.|.:...|||||..||||||:  ||.||||.          |..|||  
  Fly   163 TVKEYVKVPVPVPQPYEVIRHEKVPVHVPVDRPVPVE--VPRPYPVP----------VAKPYPVY 215

  Fly   189 VEKIVHYNVEKHVHVDKPYPVEKVVHYPVKVPVDKPVPHYIDKPVPHYVDKPVPVPVIKKVPV 251
            |||.|  ||:..||||:||||.      |||||           |.|.|.|..|...:...||
  Fly   216 VEKAV--NVQVPVHVDRPYPVY------VKVPV-----------VSHSVVKHAPTVAVSSYPV 259



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.