DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk1 and Vajk2

DIOPT Version :9

Sequence 1:NP_609688.3 Gene:Vajk1 / 34809 FlyBaseID:FBgn0028938 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_609689.3 Gene:Vajk2 / 34811 FlyBaseID:FBgn0032538 Length:270 Species:Drosophila melanogaster


Alignment Length:322 Identity:108/322 - (33%)
Similarity:133/322 - (41%) Gaps:123/322 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKSMRTATSLALVLLLATSYVRAEDEKAAAPAEEKKAEPEAKAAEAAASEDTTKSKRGLHHYEDY 65
            ||||.....:|:.:|:|.:                ..|...||.|.|...:..:.|||:.|...|
  Fly     1 MKSMLIFGLVAMCVLVANA----------------SEEAPKKAVETAEPAEKKQEKRGIGHGLGY 49

  Fly    66 HHH--------------HVPHFPVHEE-----KTLTVIKKVPVPVPIEKIVHVPVEKHIHVPVKV 111
            .:.              .||..|...|     .|.||::.|.||..:|:.|..||||.:..||||
  Fly    50 GYGPSAGGAILGSGIGVGVPVAPAVAELPTQVHTNTVVRTVQVPYQVERHVPYPVEKTVTYPVKV 114

  Fly   112 KVPKPYPV--IKHIPYEVKEIVKVPYEVPAPYPVEKQVHVPVHVHYDRPVPVKVHVPAPYPVEKK 174
            .||:||||  |.|:|  ||:|||||.|||.||||||.:.|||.:..|||..              
  Fly   115 PVPQPYPVEKIVHVP--VKQIVKVPVEVPQPYPVEKVIRVPVKIPVDRPYT-------------- 163

  Fly   175 VHVPVKVHVPAPYPVEKIVHYNVEKHVHVDKPYPVEKVVHYPVKVPVDKPVPHYIDKPVPHYVDK 239
                                      ||||||||          |||:||||:.::|.|.|    
  Fly   164 --------------------------VHVDKPYP----------VPVEKPVPYTVEKRVIH---- 188

  Fly   240 PVPVPVIKKVPVPVHVPYDRPVPVHVEKPVPYEVKVHVPAPYPVIKEVPVKVEKHVPYPVKI 301
                                .||||||:||||  ||.||        |||.||.||...|.:
  Fly   189 --------------------KVPVHVERPVPY--KVAVP--------VPVHVESHVKPAVAV 220

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk1NP_609688.3 None
Vajk2NP_609689.3 Tir_receptor_C 32..>97 CDD:284826 15/64 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.