DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Vajk1 and CG13138

DIOPT Version :9

Sequence 1:NP_609688.3 Gene:Vajk1 / 34809 FlyBaseID:FBgn0028938 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_609372.1 Gene:CG13138 / 34381 FlyBaseID:FBgn0032211 Length:549 Species:Drosophila melanogaster


Alignment Length:341 Identity:99/341 - (29%)
Similarity:141/341 - (41%) Gaps:105/341 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 EAAASEDTTKSKRGL-HHYEDYHHHHVPHFPVHEEKTLTVIKKVPVPVPIEKIVHVP----VEKH 104
            |.::.:|..:.|..: ||:..:||:|:..          :||.||.|.|:||:||||    |||.
  Fly   155 EHSSKKDAKRMKVKIKHHHHHHHHNHIKE----------LIKTVPQPYPVEKVVHVPIEKIVEKI 209

  Fly   105 IHVPVKVKVPKPYPVIKHIPYEVKEIVKVPYEVPAPYPVEKQVHVPVHVHYDRPVPVKVHVPAPY 169
            :|||..|.|                            .|||.||||:.         |:      
  Fly   210 VHVPKLVNV----------------------------TVEKIVHVPIE---------KI------ 231

  Fly   170 PVEKKVHVPVKVHVPAPYPVEKIVHYNVEKHVHVDKPYPVEKVVHYPVKVPVDKPVPHYIDKPVP 234
             |||.:|:|..|.||.||.||||    :||.|||.|||||.:.|.|||::               
  Fly   232 -VEKVIHIPKPVQVPKPYVVEKI----IEKIVHVPKPYPVLRTVPYPVEI--------------- 276

  Fly   235 HYVDKPVPVPVIKKVPVPVHVPYDRPVPVHVEKPVPYEVK-VHVPAPYPVIKEVPVKVEKHVPYP 298
                 .|||.:.||||||..|..:|.|||::....||:.: ..:...||..:|....:|...|  
  Fly   277 -----KVPVHLEKKVPVPYKVEVERKVPVYIRSSEPYKFESSSLYESYPRGEEFKFNMEMDHP-- 334

  Fly   299 VKIPVEKPVHVHIEKHVPEYHEKHVTYKEPEFHHKHIEEDHHHA---PIHHHSHPIVEHEHEVEH 360
                   |...|....:|..:..:..||..|..|....||:..:   .:.|........:.:.::
  Fly   335 -------PPREHEPSSLPSSNYYNRIYKSRELDHPPRMEDYQSSVPTQLKHDYATKTNLDQQFKN 392

  Fly   361 EFAS---------HDY 367
            |:.:         |||
  Fly   393 EYVTKSSIDPQFKHDY 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Vajk1NP_609688.3 None
CG13138NP_609372.1 IMCp 188..279 CDD:289112 54/158 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47771
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.