DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ance-3 and ACE

DIOPT Version :9

Sequence 1:NP_001033904.1 Gene:Ance-3 / 34808 FlyBaseID:FBgn0032536 Length:844 Species:Drosophila melanogaster
Sequence 2:NP_000780.1 Gene:ACE / 1636 HGNCID:2707 Length:1306 Species:Homo sapiens


Alignment Length:576 Identity:230/576 - (39%)
Similarity:347/576 - (60%) Gaps:10/576 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly   219 ESDQKGSLECTANVAAQWNFETNVNDFTQTEALNAQQRYVEFQRITAEQSKRINKDLIFDRRLYR 283
            |.|:...:.......|.||:.||:...|....|....:..........|:::.:.:.:.:..:.|
Human   655 EYDRTSQVVWNEYAEANWNYNTNITTETSKILLQKNMQIANHTLKYGTQARKFDVNQLQNTTIKR 719

  Fly   284 QLMLQSEVGPNALPLDVLDRYNRLLNEMLFLYNSAEICAYQQPFQCDLHYIPQLKDIMAKSRDWD 348
            .:....::...|||...|:.||::|.:|...|:.|.:|   .|....|...|.|.::||.||.::
Human   720 IIKKVQDLERAALPAQELEEYNKILLDMETTYSVATVC---HPNGSCLQLEPDLTNVMATSRKYE 781

  Fly   349 ELQHTWVEYHRKAGRGMRDSYEQLIDVMQEVAYVNNVTNGGEYWYLAYESGNFRQDMDIVWEQIR 413
            :|...|..:..||||.:...|.:.::::.:.|.:|...:.|:.|...||:.:..||::.::::::
Human   782 DLLWAWEGWRDKAGRAILQFYPKYVELINQAARLNGYVDAGDSWRSMYETPSLEQDLERLFQELQ 846

  Fly   414 PLYEGLHAYVRRKLRDYYGPDRINRIAPIPSHILGNMYGQSWSNVLDILIPYPGRKLIDVTPRMV 478
            |||..|||||||.|..:||...||...|||:|:||||:.|:|||:.|:::|:|....:|.|..|:
Human   847 PLYLNLHAYVRRALHRHYGAQHINLEGPIPAHLLGNMWAQTWSNIYDLVVPFPSAPSMDTTEAML 911

  Fly   479 EQGYTPQLMFQLAEEFFTSINMSAVGPEFYRNSIFEQPLD-RRVLCEPSAWDFCNRHDFRVKICT 542
            :||:||:.||:.|::||||:.:..|.|||:..|:.|:|.| |.|:|..|||||.|..|||:|.||
Human   912 KQGWTPRRMFKEADDFFTSLGLLPVPPEFWNKSMLEKPTDGREVVCHASAWDFYNGKDFRIKQCT 976

  Fly   543 DINQRSLISVHHEMAHIQYFLQYRHLPKIFRNGANPAFHQAVGDAIGLSVSTPRHLQTLGLLQRS 607
            .:|...|:..||||.|||||:||:.||...|.||||.||:|:||.:.||||||:||.:|.||...
Human   977 TVNLEDLVVAHHEMGHIQYFMQYKDLPVALREGANPGFHEAIGDVLALSVSTPKHLHSLNLLSSE 1041

  Fly   608 LDESSYDINYLFTMAIDKVAFLPFALSLDNWRYDVFSGNANKRTMNCHYWNLREKYSGIKPPVLR 672
            .....:|||:|..||:||:||:||:..:|.||:.||.|:..|...|..:|:||.||.|:.|||.|
Human  1042 GGSDEHDINFLMKMALDKIAFIPFSYLVDQWRWRVFDGSITKENYNQEWWSLRLKYQGLCPPVPR 1106

  Fly   673 SEKDFDPGAKYHIPANIPYIKYFFSTVLQFQIYRGLCRESGQYVPGDPRKPLHQCDIYRQPAAGN 737
            ::.|||||||:|||:::|||:||.|.::|||.:..||:.:|.      ..|||:||||:...||.
Human  1107 TQGDFDPGAKFHIPSSVPYIRYFVSFIIQFQFHEALCQAAGH------TGPLHKCDIYQSKEAGQ 1165

  Fly   738 ILKTLMSKGASQPWQEVLEETLREGRLDGTALREYFAPLEEWLRQENLRTNEYVGW 793
            .|.|.|..|.|:||.|.::....:..:..:|:..||.||.:|||.||....|.:||
Human  1166 RLATAMKLGFSRPWPEAMQLITGQPNMSASAMLSYFKPLLDWLRTENELHGEKLGW 1221

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ance-3NP_001033904.1 M2_ACE 216..784 CDD:188999 225/565 (40%)
ACENP_000780.1 Peptidase M2 1 30..630
Peptidase_M2 40..623 CDD:279709
Peptidase M2 2 631..1232 230/576 (40%)
Peptidase_M2 643..1221 CDD:279709 228/574 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3690
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S5260
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D266227at33208
OrthoFinder 1 1.000 - - FOG0000442
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_101615
Panther 1 1.100 - - O PTHR10514
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
87.730

Return to query results.
Submit another query.