DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ance-3 and ace2

DIOPT Version :9

Sequence 1:NP_001033904.1 Gene:Ance-3 / 34808 FlyBaseID:FBgn0032536 Length:844 Species:Drosophila melanogaster
Sequence 2:XP_002938293.2 Gene:ace2 / 100486137 XenbaseID:XB-GENE-487117 Length:862 Species:Xenopus tropicalis


Alignment Length:602 Identity:209/602 - (34%)
Similarity:331/602 - (54%) Gaps:20/602 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   205 RYQQELEKLRILLVESDQKGSLECTANVAAQWNFETNVNDFTQTEALNAQQRYVEFQRITAEQSK 269
            |.|...::.|..|...:|:..:....:..|||.:.||:.|....:...|..::..|....::.|:
 Frog    18 RSQSVTDQARDFLKRFEQEAEVLYHQSALAQWEYNTNITDENAQKMSEAGAKWSAFYTNASKNSE 82

  Fly   270 RINKDLIFDRRLYRQLMLQSEVGPNALPLDVLDRYNRLLNEMLFLYNSAEICAYQQPFQCDLHYI 334
            ..|||.|.|..:..||:..||.|...||.:...|.|::||||..:|::..:|......:| |...
 Frog    83 AFNKDYITDPSIELQLIFLSEKGSAILPAEKYTRLNQVLNEMSTIYSTHAVCKPDGSKEC-LPLE 146

  Fly   335 PQLKDIMAKSRDWDELQHTWVEYHRKAGRGMRDSYEQLIDVMQEVAYVNNVTNGGEYW------- 392
            |.|..|||:|.|::|....|..:...||:.||..||:.:|:..|.|.:|...:.|:||       
 Frog   147 PGLDKIMAESIDYEERLWAWEGWRAGAGKKMRSLYEEYVDLENEAARLNGYNDYGDYWRGNYETL 211

  Fly   393 ---YLAYESGNFRQDMDIVWEQIRPLYEGLHAYVRRKLRDYYGPDRINRIAPIPSHILGNMYGQS 454
               ..||...:..:|::..:::|.|||:.|||:||..|:..||...|:....:|:|:||:|:|:.
 Frog   212 ATDMYAYSRDDLIKDVERTYQEILPLYKELHAFVRGNLQQVYGSRYISDSGCLPAHLLGDMWGRF 276

  Fly   455 WSNVLDILIPYPGRKLIDVTPRMVEQGYTPQLMFQLAEEFFTSINMSAVGPEFYRNSIFEQPLD- 518
            |:|:..:::|||.::.|||||.||.||:|.:.||:.||.||.|:::.|:...|:.||:.|:|.| 
 Frog   277 WTNLYPLMVPYPNKESIDVTPTMVAQGWTIERMFKEAEIFFKSVDLFALNENFWNNSMLEEPKDG 341

  Fly   519 RRVLCEPSAWDFCNRHDFRVKICTDINQRSLISVHHEMAHIQYFLQYRHLPKIFRNGANPAFHQA 583
            |:|:|.|:|||. ..:|||:|:||.:|....::||||:.||||.:.|...|.:.|:|||..||:|
 Frog   342 RQVVCHPTAWDL-GMNDFRIKMCTKVNMEDFLTVHHELGHIQYDMAYAKQPFMLRDGANEGFHEA 405

  Fly   584 VGDAIGLSVSTPRHLQTLGLLQRS-LDESSYDINYLFTMAIDKVAFLPFALSLDNWRYDVFSGNA 647
            ||:.:.||.:||:||:.|.||..: :::...:||:||..|:..|..|||...|:.||:.||.|..
 Frog   406 VGEIMSLSAATPKHLKHLKLLDANFVEDQETEINFLFRQALAIVGTLPFTYMLEQWRWKVFRGEI 470

  Fly   648 NKRTMNCHYWNLREKYSGIKPPVLRSEKDFDPGAKYHIPANIPYIKYFFSTVLQFQIYRGLCRES 712
            .|......:|.::.:..|:..||...|...||.|.:|:..:..:|:|:..|:.|||....||:.:
 Frog   471 PKDQWMKTWWQMKRELVGVVEPVPHDETYCDPPALFHVSNDYSFIRYYTRTIYQFQFQDALCKAA 535

  Fly   713 GQYVPGDPRKPLHQCDIYRQPAAGNILKTLMSKGASQPWQEVLEETLREGRLDGTALREYFAPLE 777
            |..      .|||.|||.....||..|:.::..|.::.|.|.|:......::|...|.:||.||.
 Frog   536 GHV------GPLHTCDITNSKEAGAKLRAMLELGKAKSWTEALQSITGGVKMDSQPLLKYFEPLF 594

  Fly   778 EWLRQENLRTNEYVGWN 794
            .||::.|........||
 Frog   595 VWLQKNNEENRRQSTWN 611

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ance-3NP_001033904.1 M2_ACE 216..784 CDD:188999 203/579 (35%)
ace2XP_002938293.2 Peptidase_M2 23..610 CDD:396123 205/594 (35%)
Collectrin 622..772 CDD:407175
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 440 1.000 Inparanoid score I1623
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D266227at33208
OrthoFinder 1 1.000 - - FOG0000442
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.060

Return to query results.
Submit another query.