DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and ACYP1

DIOPT Version :9

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001289546.1 Gene:ACYP1 / 97 HGNCID:179 Length:129 Species:Homo sapiens


Alignment Length:89 Identity:39/89 - (43%)
Similarity:61/89 - (68%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPL 72
            |.::|:||:||||.||:|...:.|.|||.||..|:.||||:|.::|..:::..|:|||.|.|||.
Human    39 SVDYEIFGKVQGVFFRKHTQAEGKKLGLVGWVQNTDRGTVQGQLQGPISKVRHMQEWLETRGSPK 103

  Fly    73 SSIEKVEFSSQRERDRYGYANFHI 96
            |.|:|..|::::...:..|::|.|
Human   104 SHIDKANFNNEKVILKLDYSDFQI 127

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 39/89 (44%)
ACYP1NP_001289546.1 Acylphosphatase 40..127 CDD:376373 37/86 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165159988
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - mtm8538
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1110.720

Return to query results.
Submit another query.