powered by:
Protein Alignment Acyp and AT5G03370
DIOPT Version :9
Sequence 1: | NP_001285916.1 |
Gene: | Acyp / 34807 |
FlyBaseID: | FBgn0025115 |
Length: | 120 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_195957.1 |
Gene: | AT5G03370 / 831859 |
AraportID: | AT5G03370 |
Length: | 171 |
Species: | Arabidopsis thaliana |
Alignment Length: | 72 |
Identity: | 26/72 - (36%) |
Similarity: | 38/72 - (52%) |
Gaps: | 2/72 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 15 GRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLSSIEKVE 79
||||||.:|...:..|:.||::||..|...|:|:....|.|..:|.|.:..| .|.|.:.:..:|
plant 90 GRVQGVCYRNWTVENAEQLGIKGWVRNRRDGSVEALFSGPPEAVDEMHQRCR-RGPPAAMVTGLE 153
Fly 80 -FSSQRE 85
|.|..|
plant 154 AFPSTEE 160
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
1 |
1.000 |
47 |
1.000 |
Domainoid score |
I4519 |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG3360 |
Hieranoid |
1 |
1.000 |
- |
- |
|
|
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1502266at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0001379 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
1 |
0.900 |
- |
- |
|
OOG6_101060 |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
1 |
0.960 |
- |
- |
|
|
|
8 | 7.680 |
|
Return to query results.
Submit another query.