DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and CG34161

DIOPT Version :9

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001097143.1 Gene:CG34161 / 5740441 FlyBaseID:FBgn0085190 Length:125 Species:Drosophila melanogaster


Alignment Length:96 Identity:46/96 - (47%)
Similarity:61/96 - (63%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 ATHNVHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLR 66
            |.:.:.||:|||||.||||.||:|..:||..||:.|||||:::|||:|.:||...:|..||.||:
  Fly    29 AQNQIFSCQFEVFGHVQGVFFRKHTQKKAIELGITGWCMNTTQGTVQGMLEGSLDQMTDMKYWLQ 93

  Fly    67 TTGSPLSSIEKVEFSSQRERDRYGYANFHIK 97
            ..|||.|.|||..||.........:..|.|:
  Fly    94 HKGSPRSVIEKAVFSENEPLPINNFKMFSIR 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 44/90 (49%)
CG34161NP_001097143.1 Acylphosphatase 35..124 CDD:279097 44/88 (50%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471700
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5343
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D145178at6656
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm26072
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - P PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
1211.810

Return to query results.
Submit another query.