DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and acyp1

DIOPT Version :9

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001016160.1 Gene:acyp1 / 548914 XenbaseID:XB-GENE-5909301 Length:98 Species:Xenopus tropicalis


Alignment Length:96 Identity:37/96 - (38%)
Similarity:56/96 - (58%) Gaps:0/96 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MATHNVHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWL 65
            ||.....|.::||||:||||.||::...:...|||.||..|:..|||.|.::|...::..|:.||
 Frog     1 MAEEEPISVDYEVFGKVQGVFFRKYTQAEGNRLGLVGWVRNTDTGTVTGQLQGPSEKVREMQIWL 65

  Fly    66 RTTGSPLSSIEKVEFSSQRERDRYGYANFHI 96
            :..|||.|.|.|.:|.::|...:..::.|.|
 Frog    66 QKKGSPKSRITKAQFQNERRIKKLEHSTFSI 96

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 35/91 (38%)
acyp1NP_001016160.1 Acylphosphatase 9..96 CDD:376373 33/86 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - mtm9551
Panther 1 1.100 - - O PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
77.030

Return to query results.
Submit another query.