DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and CG11052

DIOPT Version :9

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001246977.1 Gene:CG11052 / 49997 FlyBaseID:FBgn0040524 Length:149 Species:Drosophila melanogaster


Alignment Length:94 Identity:46/94 - (48%)
Similarity:61/94 - (64%) Gaps:0/94 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGS 70
            |.||:|||||.||||:||.:.||:|:.||:||||.|::..||||.|:......:.|:.||:.|||
  Fly    56 VFSCQFEVFGIVQGVSFRMYTLRRAQKLGVRGWCKNTNENTVKGEIQAHRHSFESMRLWLKHTGS 120

  Fly    71 PLSSIEKVEFSSQRERDRYGYANFHIKPD 99
            |.|.|:|..||...|...:.:.||.|..|
  Fly   121 PTSRIDKCIFSETTELSEFTFTNFSIVVD 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 44/90 (49%)
CG11052NP_001246977.1 Acylphosphatase 56..146 CDD:279097 44/89 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471706
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5343
Isobase 1 0.950 - 0 Normalized mean entropy S5759
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D145178at6656
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm26072
orthoMCL 1 0.900 - - OOG6_101060
Panther 1 1.100 - - P PTHR10029
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
1312.760

Return to query results.
Submit another query.