DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and Acyp2

DIOPT Version :9

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001262612.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster


Alignment Length:92 Identity:42/92 - (45%)
Similarity:58/92 - (63%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGS 70
            :.:.:||:|||||||.||:|...:||.||:||||||:..|||||.:|.....:..||.||.....
  Fly    10 IFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRI 74

  Fly    71 PLSSIEKVEFSSQRERDRYGYANFHIK 97
            |.:.:.|.|||..:|.:.|.:.:|.||
  Fly    75 PNAKVSKAEFSQIQEIEDYTFTSFDIK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 40/90 (44%)
Acyp2NP_001262612.1 Acylphosphatase 12..101 CDD:279097 40/88 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45471702
Domainoid 1 1.000 47 1.000 Domainoid score I4519
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5343
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG56793
OrthoDB 1 1.010 - - D145178at6656
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm26072
orthoMCL 1 0.900 - - OOG6_101060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
1110.710

Return to query results.
Submit another query.