DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and Acyp2

DIOPT Version :10

Sequence 1:NP_523563.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_650491.1 Gene:Acyp2 / 41910 FlyBaseID:FBgn0038363 Length:102 Species:Drosophila melanogaster


Alignment Length:92 Identity:42/92 - (45%)
Similarity:58/92 - (63%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGS 70
            :.:.:||:|||||||.||:|...:||.||:||||||:..|||||.:|.....:..||.||.....
  Fly    10 IFALDFEIFGRVQGVFFRKHTSHEAKRLGVRGWCMNTRDGTVKGQLEAPMMNLMEMKHWLENNRI 74

  Fly    71 PLSSIEKVEFSSQRERDRYGYANFHIK 97
            |.:.:.|.|||..:|.:.|.:.:|.||
  Fly    75 PNAKVSKAEFSQIQEIEDYTFTSFDIK 101

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_523563.1 Acylphosphatase 9..96 CDD:425830 40/86 (47%)
Acyp2NP_650491.1 Acylphosphatase 13..100 CDD:425830 40/86 (47%)

Return to query results.
Submit another query.