DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and CG18371

DIOPT Version :10

Sequence 1:NP_523563.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_610923.1 Gene:CG18371 / 36556 FlyBaseID:FBgn0033893 Length:110 Species:Drosophila melanogaster


Alignment Length:92 Identity:40/92 - (43%)
Similarity:57/92 - (61%) Gaps:0/92 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VHSCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGS 70
            :.||.||:|||||||..|:.....|....:|||.||:..|||||.:||...:::|:|.||...||
  Fly     8 IFSCGFELFGRVQGVCLRKQTRDLATMNQVRGWVMNTDEGTVKGQLEGTLPKVNVLKFWLLNIGS 72

  Fly    71 PLSSIEKVEFSSQRERDRYGYANFHIK 97
            |.|.||:.||:..:|...:.::.|.|:
  Fly    73 PRSIIERAEFTPTKEITSHNFSRFSIR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_523563.1 Acylphosphatase 9..96 CDD:425830 38/86 (44%)
CG18371NP_610923.1 Acylphosphatase 13..98 CDD:425830 37/84 (44%)

Return to query results.
Submit another query.