DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and CG10970

DIOPT Version :9

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:NP_001285032.1 Gene:CG10970 / 31830 FlyBaseID:FBgn0030078 Length:103 Species:Drosophila melanogaster


Alignment Length:89 Identity:29/89 - (32%)
Similarity:42/89 - (47%) Gaps:0/89 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 CEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVMKEWLRTTGSPLS 73
            |:|||.|||....|...||.:|..|||||:....|....||.:||....:|..|:.:......:.
  Fly    11 CDFEVRGRVPKDAFELFALVQANALGLRGFIAQVSEEKFKGRLEGEGKVIDAFKKLILAAADYVQ 75

  Fly    74 SIEKVEFSSQRERDRYGYANFHIK 97
            :|::....:.:....|.|..|.||
  Fly    76 AIKEFIIKNLKVIQEYTYKTFEIK 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 27/87 (31%)
CG10970NP_001285032.1 Acylphosphatase 11..99 CDD:294372 27/87 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3360
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.