DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Acyp and acyp2

DIOPT Version :9

Sequence 1:NP_001285916.1 Gene:Acyp / 34807 FlyBaseID:FBgn0025115 Length:120 Species:Drosophila melanogaster
Sequence 2:XP_005172988.1 Gene:acyp2 / 101886626 ZFINID:ZDB-GENE-130530-886 Length:87 Species:Danio rerio


Alignment Length:54 Identity:25/54 - (46%)
Similarity:35/54 - (64%) Gaps:0/54 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 SCEFEVFGRVQGVNFRRHALRKAKTLGLRGWCMNSSRGTVKGYIEGRPAEMDVM 61
            |.:|||||.||||.||.:...:.|.||:.||..|:.:|||.|.::|.|.::..|
Zfish    34 SVDFEVFGNVQGVCFRMYTEAEGKKLGVTGWVKNTRQGTVVGQVQGPPEKVKEM 87

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
AcypNP_001285916.1 Acylphosphatase 6..97 CDD:279097 25/54 (46%)
acyp2XP_005172988.1 Acylphosphatase 33..>87 CDD:279097 24/52 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 66 1.000 Domainoid score I9904
eggNOG 1 0.900 - - E1_KOG3360
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I5343
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1502266at2759
OrthoFinder 1 1.000 - - FOG0001379
OrthoInspector 1 1.000 - - otm26072
orthoMCL 1 0.900 - - OOG6_101060
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1110
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
98.770

Return to query results.
Submit another query.