DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smg5 and EST1

DIOPT Version :9

Sequence 1:NP_001285914.1 Gene:Smg5 / 34804 FlyBaseID:FBgn0019890 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_013334.1 Gene:EST1 / 850934 SGDID:S000004223 Length:699 Species:Saccharomyces cerevisiae


Alignment Length:270 Identity:49/270 - (18%)
Similarity:98/270 - (36%) Gaps:79/270 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   619 DNEDVVIEEEKIVYPN---EVERRSNSQEADSEELLRSFE-----VLQLNFKSAEDAQSKPVAPP 675
            |||:|..|..::.:.|   .:::...|:....|....:|.     :.:.:.:..|:...|     
Yeast     2 DNEEVNEECMRLFFKNARAHLDKHLTSRLTCDENAYITFRCFLDGIHRKSTRFLEELLLK----- 61

  Fly   676 PVSFSEPPKKLVYRNKYTKINPNIVIDCLHNEPTIRALKMLFDWLRINPEILIGCYHSNPEFVHK 740
                   .:.:.:.|.|.:||.:::       |.:  ||:|  ||:|:...|....|    :.|.
Yeast    62 -------QENMYHNNNYERINDSVI-------PLV--LKLL--WLQIHEPTLQWFEH----WFHD 104

  Fly   741 IMKLLNYCNIDIF-------------TRKVYFERDLLTTANVRDSLVELFDVRANVPLTEDFAFK 792
            ||:|.|.....:|             |.:.|::        :.:.|...:|:.:   :..:..|.
Yeast   105 IMRLSNRRKFRVFRIFQKKMIQFFKITHRYYYD--------IIEHLCAKYDMNS---VISNALFA 158

  Fly   793 NFDIFQSTQITLDWETIIRERVTPQEESILRIFKMVDFGFFICKQKKFNYRFCV---KTRRFTET 854
            ..::.|.|           :.::..|:.||.....:.|...|..|:      ||   .:..|.:|
Yeast   159 KLNLMQYT-----------DGLSTHEKIILNTSNPLTFSIVISLQR------CVINLGSTHFYKT 206

  Fly   855 QKKKQREEKK 864
            ...|...:.|
Yeast   207 LLNKPSNKPK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smg5NP_001285914.1 EST1 99..222 CDD:287360
EST1_DNA_bind 240..478 CDD:287359
PIN_Smg5 1012..1173 CDD:189054
EST1NP_013334.1 EST1 82..209 CDD:402133 31/162 (19%)
EST1_DNA_bind 224..508 CDD:402132
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15696
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.