DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smg5 and est1

DIOPT Version :9

Sequence 1:NP_001285914.1 Gene:Smg5 / 34804 FlyBaseID:FBgn0019890 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_596232.1 Gene:est1 / 2540492 PomBaseID:SPBC2D10.13 Length:490 Species:Schizosaccharomyces pombe


Alignment Length:454 Identity:93/454 - (20%)
Similarity:176/454 - (38%) Gaps:127/454 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 FQHEIEEK-RSLLVQLCKQII--FKDYQSVGKKVREVMWRRGYYEFIAFVKKNWHKQCQDAATAQ 131
            |:|::.|| .::.:::.|:::  .|..|:...:..:::|...:|:.|...:..:.:........:
pombe    29 FKHDLYEKIIAIEIEVEKKLLNRLKSIQTNTFERPDIIWSCCHYKIIQHFRSRFREIHPRHVVEK 93

  Fly   132 ENMQKL-ERFL--CAGIFNYKRLSARMEEIYDLDLKYLIDF------SIISDGYISDMIGDTMES 187
            :..:|: .:||  || || |:...:.:...:.|| .|...|      :.:|....:|.:....|:
pombe    94 KKTKKVFFKFLKTCA-IF-YQTCISELISKFQLD-SYRPFFCKWTSSATVSSTISNDEMSSIPEA 155

  Fly   188 SHSGTHAVDKSLEAVSFALDTIHSSLLSLGDLHRYFLDFRIDSKLSISK----EQVAKYYLEAFK 248
            |:|..|     :|    ||:.:::..:.|||:.||       |...:.|    ::...:|..|.:
pombe   156 SYSRNH-----ME----ALECVYNCFIYLGDMARY-------SSTCLKKRGAYDRALGFYDLAHR 204

  Fly   249 LNPAIGMAQNQLGTLHYGQNHDLDSTYHYLYSLVCIIPFELSENNL--------NKLFAKHTEY- 304
            ..|..||.:||:..:.......::|.|.:..:|....|.:.:..||        .:.||.|.|: 
pombe   205 TLPGNGMHRNQIAVVWASDECIVESIYWFSSALCSEDPPKSALLNLLKQLIAFYRRCFAVHFEFV 269

  Fly   305 -----------------LERMDPEK-------------LDFNIEDFFARFYLIVDIFFFDKEVPD 339
                             |:.:.|.|             |..||.:.   .|...::::....   
pombe   270 SPMMILLFIISDCCIHSLKEIQPFKCPSIMVKDLENSLLQSNIRNV---GYEKKNLYYISSA--- 328

  Fly   340 FNALCHCVLIDLRKILCSQQLRVPEPSIFKIVSILFF----CLSKLKMINSPKVYSLHAFLVAAC 400
            |:.|.||     |...|:.:||   ...::..|.||.    |..:::...:|..|          
pombe   329 FSNLLHC-----RYFNCNDRLR---SFYYRFSSWLFHQTLACAKEVESERAPTSY---------- 375

  Fly   401 SDLMDACIVSIEQTILARA----------QDNERFQAEY-----EERFQEFDTVVRKSRNEYKN 449
               :.:|:.|| :.||||.          :.||..|..|     |:.|:|      .|.|:..|
pombe   376 ---LTSCLPSI-KVILARVLESSPAFGFIERNELEQLSYHFRICEKFFKE------SSENKMLN 429

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smg5NP_001285914.1 EST1 99..222 CDD:287360 27/131 (21%)
EST1_DNA_bind 240..478 CDD:287359 55/268 (21%)
PIN_Smg5 1012..1173 CDD:189054
est1NP_596232.1 EST1 64..184 CDD:287360 30/138 (22%)
EST1_DNA_bind 195..450 CDD:287359 55/269 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2162
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15696
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.