DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Smg5 and SPBC2F12.03c

DIOPT Version :9

Sequence 1:NP_001285914.1 Gene:Smg5 / 34804 FlyBaseID:FBgn0019890 Length:1177 Species:Drosophila melanogaster
Sequence 2:NP_595712.1 Gene:SPBC2F12.03c / 2540346 PomBaseID:SPBC2F12.03c Length:891 Species:Schizosaccharomyces pombe


Alignment Length:344 Identity:73/344 - (21%)
Similarity:133/344 - (38%) Gaps:101/344 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 ASKQLDDAKRNVQSVGQLFQHEIEEKRSLLVQLCKQI-------IFKDYQ-SVGKKVREVMWRRG 108
            :|:..:..|||.::   |:....::|...:.:||::|       |..|.. |:.|.|...:|.|.
pombe    80 SSEPTEKKKRNKEA---LWLRARQKKWKEIFELCQKITSLLGGTILIDVSFSMEKDVLTYLWMRV 141

  Fly   109 YYEFIAFVKKNWHKQCQDAATAQENMQKLE-------RFLCAGIFNYKRLSARMEEIYDLD-LKY 165
            :|:.|:|.|...::     |:.|.:.:.|.       ::|.:.|..|..|.|.:.|:|.|. |..
pombe   142 HYQVISFFKHRIYE-----ASTQHDPELLSSLVTMHIQYLNSTIQFYTTLIAIIGELYHLQCLSP 201

  Fly   166 LIDF--------------------------------------SIISDGYIS-DMIGDTMESSHSG 191
            |..|                                      ||..|..:. |.:...:..|.|.
pombe   202 LTSFFTSCVTPKTILESPLRKQGSHNWKTSTNSQSRLAALFSSIFEDSCLEVDSVKRLLSGSPSS 266

  Fly   192 THA---VDKSLEAVSF--ALD---------TIHSSLLSLGDLHRYFLDFRIDSKLSISKEQVA-K 241
            :.:   .|.|..::::  ||.         .::.||:.:||:|||..:.|   ..::...||: :
pombe   267 SSSPLKKDSSSNSLTYEPALTDHKPQYLVLCVYRSLIYIGDVHRYLAEVR---SPNVPDYQVSRR 328

  Fly   242 YYLEAFKLNPAIGMAQNQLGTLHY------------GQNHDLDSTYH-----YLYSLVCIIPF-- 287
            ||:.|..:.|..|:..:|||.:..            ||:..|....:     .:.:|..|..|  
pombe   329 YYVMAANVAPDYGVHFHQLGLIEVADARSSSRKSSSGQSSSLKGNVNVEDKRLIQALPAISFFFL 393

  Fly   288 -ELSENNLNKLFAKHTEYL 305
             .:|.||:....||.:.::
pombe   394 SSISPNNVAASSAKTSLFI 412

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Smg5NP_001285914.1 EST1 99..222 CDD:287360 36/183 (20%)
EST1_DNA_bind 240..478 CDD:287359 19/87 (22%)
PIN_Smg5 1012..1173 CDD:189054
SPBC2F12.03cNP_595712.1 EST1 132..314 CDD:287360 38/186 (20%)
EST1_DNA_bind 326..647 CDD:287359 19/87 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR15696
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.