DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and Smap1

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_001344324.1 Gene:Smap1 / 98366 MGIID:2138261 Length:467 Species:Mus musculus


Alignment Length:310 Identity:87/310 - (28%)
Similarity:124/310 - (40%) Gaps:81/310 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   710 RVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLAIG 774
            |...|.:|.||.|..|.|||.|:||.:||.|:|:|||||.|||:|:|:.||.|....:..|..:|
Mouse    26 REEDNKYCADCEAKGPRWASWNIGVFICIRCAGIHRNLGVHISRVKSVNLDQWTPEQIQCMQDMG 90

  Fly   775 NSLANSVWESNTRQ--RVKPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIEA 837
            |:.|..::|:|..:  |...|.||    .|.::|.|||.|::..                     
Mouse    91 NTKARLLYEANLPENFRRPQTDQA----VEFFIR
DKYEKKKYYD--------------------- 130

  Fly   838 VIRADIKSIVSILANCPSEVTNANVSARD------VRTPLLLACAIGNLAIAQLLIWNGANIKHT 896
                  |:.::|          .|:|:.|      |.:|.|.|....|....:       ..|..
Mouse   131 ------KNAIAI----------TNISSSDAPLQPLVSSPSLQAAVDKNKLEKE-------KEKKK 172

  Fly   897 DHEGR------------TCLAYARAAQSLATAKSIKAAAAAQ-----AGTTIPAPAPPTNGGIPA 944
            |.:.|            |.....:..|.|...||.....||:     .|...||.||.|||    
Mouse   173 DEKKREKEPEKPAKPLTTEKLPKKEEQQLEPKKSTSPKNAAEPTIDLLGLDGPAEAPVTNG---- 233

  Fly   945 PQYNVEDTTALVELLEGLGCPEAAPLTASGTLPRRRDTLGTPYEKSVSGV 994
               |.....||.:.|:..|...:.||.|: .:|..:.|...|...::|.|
Mouse   234 ---NPATAPALSDDLDIFGPMISNPLPAA-VMPPAQGTASVPAPATLSTV 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 46/109 (42%)
ANK <834..907 CDD:238125 14/90 (16%)
ANK repeat 834..866 CDD:293786 4/31 (13%)
Ank_5 859..907 CDD:290568 12/65 (18%)
ANK repeat 868..897 CDD:293786 5/28 (18%)
Smap1NP_001344324.1 ArfGap 20..120 CDD:307528 41/97 (42%)
Med15 <343..>451 CDD:312941
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.