DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and ASAP2

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_011508705.1 Gene:ASAP2 / 8853 HGNCID:2721 Length:1020 Species:Homo sapiens


Alignment Length:707 Identity:170/707 - (24%)
Similarity:263/707 - (37%) Gaps:169/707 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   312 QPARPTTPQG------------------NRLGLAPYQAPTNGQRGQQQLP-------LRMSADFA 351
            :|||...||.                  |..|||..:   |.::..|.|.       .|...|..
Human    45 RPARRLRPQALDVDRMVLYKMKKSVKAINSSGLAHVE---NEEQYTQALEKFGGNCVCRDDPDLG 106

  Fly   352 QAEQKL----WSLQAASSSTINENNNITKYNPGAANSLQGDCSQVQ--LRDPRDLAPPPGKELPT 410
            .|..|.    ..|.|...:.|...|||..:  ...:.|:||...|:  |:.|.|.|   .|:..|
Human   107 SAFLKFSVFTKELTALFKNLIQNMNNIISF--PLDSLLKGDLKGVKGDLKKPFDKA---WKDYET 166

  Fly   411 PTSTPTTSRKSRRRSNLFIPSSSKKA----DKEKEPKSSELG------SGRSIPIKQGYLYKRSS 465
            ..:.....:|...:.:..|.:....|    :.|||.:..:|.      ....|.||:|.      
Human   167 KITKIEKEKKEHAKLHGMIRTEISGAEIAEEMEKERRFFQLQMCEYLLKVNEIKIKKGV------ 225

  Fly   466 KSLNKEWKKKYVTLCD---DGRL---TYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGSKSII 524
             .|.:...|.:...|:   ||..   :..||:.....|:|         |:| ..|.....:.|.
Human   226 -DLLQNLIKYFHAQCNFFQDGLKAVESLKPSIETLSTDLH---------TIK-QAQDEERRQLIQ 279

  Fly   525 TNSALTSSLMANGQRAQNTLSDGIGCLTLAKDNQRKLSEKLSL-LGAGSIAAGAGGEPLKSNSSQ 588
            ....|.|:|....:.::             :|:|.:.|...|| ...|:...|.     :.|.|.
Human   280 LRDILKSALQVEQKESR-------------RDSQIRQSTAYSLHQPQGNKEHGT-----ERNGSL 326

  Fly   589 QTSGDEGI-------AMSNSNSQTFIAGEVAN-AGNKLEAQTPNVKKRHRRMKSSSVKANEADDN 645
            ....| ||       ..|..|....|:...|| ...||...|..||......|.           
Human   327 YKKSD-GIRKVWQKRKCSVKNGFLTISHGTANRPPAKLNLLTCQVKTNPEEKKC----------- 379

  Fly   646 DGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFKSLQSI--------ESSKTKQATSTDLA 702
                |.::|.| :.:||:|.:.:|...|::.::....::|.:.        |::..::.|...::
Human   380 ----FDLISHD-RTYHFQAEDEQECQIWMSVLQNSKEEALNNAFKGDDNTGENNIVQELTKEIIS 439

  Fly   703 AMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHL 767
            .:    ||:.||..|.|||||:|.|.|.|||:|.||||||:||.||.|.|:::||.||...:..|
Human   440 EV----QRMTGNDVCCDCGAPDPTWLSTNLGILTCIECSGIHRELGVHYSRMQSLTLDVLGTSEL 500

  Fly   768 SVMLAIGNSLANSVWES--NTRQRVKPTSQASREDKERWVRSKYEAKEFLTP--LGNGSSAHPSP 828
            .:...|||:..|.:.|.  .....|||...:....::.::.:||..:.:...  ..|.:..|   
Human   501 LLAKNIGNAGFNEIMECCLPAEDSVKPNPGSDMNARKDYITAKYIERRYARKKHADNAAKLH--- 562

  Fly   829 SPGQQLIEAVIRADIKSIVSI------------LANC--PSEVTNANVSARDV-RTPLLLACAIG 878
                .|.|||...||..::..            |||.  |.| |..:::.|.| ||         
Human   563 ----SLCEAVKTRDIFGLLQAYADGVDLTEKIPLANGHEPDE-TALHLAVRSVDRT--------- 613

  Fly   879 NLAIAQLLIWNGANIKHTDHEGRTCLAYARAAQSLATAKSI---KAA--AAAQAGTT 930
            :|.|...|:.|..|:.....:|.|.|.|.....:....|.:   ||:  .|.::|.|
Human   614 SLHIVDFLVQNSGNLDKQTGKGSTALHYCCLTDNAECLKLLLRGKASIEIANESGET 670

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 51/249 (20%)
PH 454..>521 CDD:278594 15/72 (21%)
ArfGap 702..818 CDD:279720 44/119 (37%)
ANK <834..907 CDD:238125 24/87 (28%)
ANK repeat 834..866 CDD:293786 12/45 (27%)
Ank_5 859..907 CDD:290568 12/48 (25%)
ANK repeat 868..897 CDD:293786 7/28 (25%)
ASAP2XP_011508705.1 BAR 34..259 CDD:299863 50/228 (22%)
PH_ASAP 311..417 CDD:270071 27/127 (21%)
PH 320..407 CDD:278594 24/108 (22%)
ArfGap 435..552 CDD:279720 44/120 (37%)
ANK repeat 564..596 CDD:293786 9/31 (29%)
ANK <593..687 CDD:238125 24/88 (27%)
ANK repeat 600..632 CDD:293786 11/41 (27%)
Ank_5 621..675 CDD:290568 13/50 (26%)
ANK repeat 634..665 CDD:293786 7/30 (23%)
SH3_ASAP2 962..1017 CDD:212899
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.