DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and AGE1

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_010812.3 Gene:AGE1 / 852136 SGDID:S000002932 Length:482 Species:Saccharomyces cerevisiae


Alignment Length:468 Identity:108/468 - (23%)
Similarity:171/468 - (36%) Gaps:165/468 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   494 YMDDVHGKEIPLQYVTVKVPGQKPRGSKSIITNSALTSSLMANGQRAQNTLSDGIGC-------- 550
            |..|::...:||          ..:|:.:...:.|...|...|..:..|.|...:.|        
Yeast     4 YTTDINKNVVPL----------FSKGTVARTASKAQYPSWCNNALKLTNILLKSLRCKFQTNRCE 58

  Fly   551 --------LTLAKDNQRKLSEKLSLLGAGSIAAGAGGEPLKSNS------SQQTSGDE------- 594
                    ..:.|.....::.|.||:......:...|.|.:|..      |.:.||.:       
Yeast    59 DDRGFEVYCVILKSIALLMAAKESLILLQIPPSLPSGFPFRSPQLSFTYLSTRLSGSQHKSTHSH 123

  Fly   595 -------GIAMSNSNSQTFIAGEVANAGNKLEAQTPNVKKRHRRMKSSSVKANEADDNDGYEFYI 652
                   .|..|:|||         |:.|::..:|.: .|:|.:                     
Yeast   124 HINHQTHPIHSSSSNS---------NSNNRIPTKTDS-SKQHTQ--------------------- 157

  Fly   653 VSLDSKQWHFEAAN--SEERDEWVAAVEQEIFKSLQSIESSKTKQATSTDLAAMLAIRQRVPGNG 715
                    ||..||  :..|||.::.|        :.|:.|..|                     
Yeast   158 --------HFSFANAGASNRDELLSIV--------RKIDKSNLK--------------------- 185

  Fly   716 FCVDCGA-PNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGLDDWPSPHLSVMLA--IGNSL 777
             |.|||: ...||.|:||..::||:||||||:|||||||:|||.||::.|..|..:|.  :.||.
Yeast   186 -CCDCGSTATVEWVSINLLCILCIKCSGVHRSLGSHISKIRSLTLDNFTSLELMHLLQNNVSNSN 249

  Fly   778 ANSVWESNTRQRVKPTSQASREDKER--WVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIEAV-- 838
            .|:::|||.|........|:.:|.||  ::..||:.|:|:.....|..|..     :.||:|:  
Yeast   250 VNAIYESNLRNFPVKKITANSDDSERSKFIIDKYQFKKFVIDSNQGREASL-----KSLIKAIHL 309

  Fly   839 ------IRADIKSIVSILANCPSEVTNANVSARDVR-----------------TPLLLACAIGNL 880
                  .||..:|..|:     .|:|.:.....|:.                 ||:..       
Yeast   310 DSVFMMQRAIAQSKYSL-----RELTASEKEQNDLNHSSIFQYSLKHYEIVDGTPIFF------- 362

  Fly   881 AIAQLLIWNGANI 893
             |.:.|:.||.:|
Yeast   363 -ITEFLLCNGIHI 374

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 39/229 (17%)
PH 454..>521 CDD:278594 5/26 (19%)
ArfGap 702..818 CDD:279720 47/120 (39%)
ANK <834..907 CDD:238125 17/85 (20%)
ANK repeat 834..866 CDD:293786 9/39 (23%)
Ank_5 859..907 CDD:290568 8/52 (15%)
ANK repeat 868..897 CDD:293786 7/43 (16%)
AGE1NP_010812.3 COG5347 164..480 CDD:227651 73/259 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343816
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm46810
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R258
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.860

Return to query results.
Submit another query.