DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and DOC2A

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_024306240.1 Gene:DOC2A / 8448 HGNCID:2985 Length:467 Species:Homo sapiens


Alignment Length:436 Identity:86/436 - (19%)
Similarity:137/436 - (31%) Gaps:178/436 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly   306 PLPPQVQPARPTTPQGNRLGLAPYQAPTNGQRGQQQLPLRMSADFAQ--AEQKLWSLQAASSSTI 368
            |.|..|||     |:|..... |.||.:      ..|||...:...|  |.|:.|          
Human   123 PGPVCVQP-----PEGAHSSF-PSQACS------FVLPLPPPSGLLQGPALQEGW---------- 165

  Fly   369 NENNNITKYNPGAANSLQGDCSQVQLRDPRD---LAPPPGKELPTPTSTPTTSRKSRRRSNLFIP 430
                   :..|||::.|  .|..:|...|.|   ||.|..|                    |.:.
Human   166 -------REVPGASSPL--PCPPLQGLKPMDFNGLADPYVK--------------------LHLL 201

  Fly   431 SSSKKADKEKEPKSSELGSGRSIPIKQGYLYKRSSKSLNKEW----------------KKKYVTL 479
            ..:.||:|.|.                    |....:||..|                |...:.:
Human   202 PGACKANKLKT--------------------KTQRNTLNPVWNEDLTYSGITDDDITHKVLRIAV 246

  Fly   480 CDDGRLTYHPSLHDYMDDVHGKEIPLQYVTVKVPGQKPRGSKSIITNSALTS-SLMANGQRAQNT 543
            ||:.:|::    ::::.::   .:||:.:.   |.||...:..:.....|.| |.|:...|    
Human   247 CDEDKLSH----NEFIGEI---RVPLRRLK---PSQKKHFNICLERQVPLASPSSMSAALR---- 297

  Fly   544 LSDGIGC----LTLAKDNQRKLSEK----LSLLGAGSIAAGAGGEPLKSNSSQQTSGDEGI---- 596
               ||.|    |..|:..|..|.|:    |||                |.||::.....||    
Human   298 ---GISCYLKELEQAEQGQGLLEERGRILLSL----------------SYSSRRRGLLVGILRCA 343

  Fly   597 ---AM-----SNSNSQTFIAGEVANAGNKLEAQTPNVKKRHRRMKSSSVKANEADDNDGYEFYIV 653
               ||     |:...:|::..:|            :.|.:|:..........|.::...||..:.
Human   344 HLAAMDVNGYSDPYVKTYLRPDV------------DKKSKHKTCVKKKTLNPEFNEEFFYEIELS 396

  Fly   654 SLDSKQ-----WHFE---------------AANSEERDEWVAAVEQ 679
            :|.:|.     |.::               .|..|.|..|...::|
Human   397 TLATKTLEVTVWDYDIGKSNDFIGGVSLGPGARGEARKHWSDCLQQ 442

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 52/286 (18%)
PH 454..>521 CDD:278594 13/82 (16%)
ArfGap 702..818 CDD:279720
ANK <834..907 CDD:238125
ANK repeat 834..866 CDD:293786
Ank_5 859..907 CDD:290568
ANK repeat 868..897 CDD:293786
DOC2AXP_024306240.1 C2A_Rabphilin_Doc2 90..280 CDD:176000 47/237 (20%)
C2B_Rabphilin_Doc2 321..453 CDD:176030 26/150 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.