DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and AGD4

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_001320312.1 Gene:AGD4 / 837629 AraportID:AT1G10870 Length:780 Species:Arabidopsis thaliana


Alignment Length:600 Identity:143/600 - (23%)
Similarity:225/600 - (37%) Gaps:214/600 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   432 SSKKADKEKEPKSSELGSGRSIPIKQGYLYKRSSKSLNKEWKKKYVTLCDDGRLTYHPSLHDYMD 496
            :|..||||              .||||||.|||| ||..:||:|:..|...|.:.|:        
plant   281 TSLTADKE--------------VIKQGYLLKRSS-SLRTDWKRKFFVLDSHGSMYYY-------- 322

  Fly   497 DVHGKEIPLQYVTVKVPGQKPRGSKSIITNSALTSSLMANGQRAQNTLSDGIGCLTLAKDNQRKL 561
                               :..|:||      :.|....:|....||   |:.....|:.|:   
plant   323 -------------------RTNGNKS------MGSHHHYSGSSDHNT---GVFGRFRARHNR--- 356

  Fly   562 SEKLSLLGAGSIAAGAGGEPLKSNSSQQTSGDEGIAMSNSNSQTFIAGEVANAGNKLEAQTPNVK 626
                    :||:..|:.|.                                   |.::.:|..:|
plant   357 --------SGSLTEGSLGY-----------------------------------NTIDLRTSLIK 378

  Fly   627 KRHRRMKSSSVKANEADDNDGYEFYIVSLDSKQWHFEAANSEERDEWVAAVEQEIFKSLQS---- 687
            .             :|:|.|....:.:....|.:..:|.|..:|.:||..:.:.|...|.|    
plant   379 L-------------DAEDMDLRLCFRIISPQKTYTLQAENGADRMDWVNKITKAIGTLLNSHFLQ 430

  Fly   688 -------------------------IESSKTKQATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEW 727
                                     |..:.::|....|::.:|   :.:|||..|.:|.||.|:|
plant   431 QSPVRYLDKDNSSSAPANAVVSGDQIRHNDSRQNIGDDVSTIL---RGLPGNNACAECNAPEPDW 492

  Fly   728 ASLNLGVLMCIECSGVHRNLGSHISKVRSLGLD--DWPSPHLSVMLAIGNSLANSVWES------ 784
            ||||||||:||:|||||||||.||||||||.||  .|....|.:...:||...||:||.      
plant   493 ASLNLGVLLCIQCSGVHRNLGVHISKVRSLSLDVKVWEPTILDLFRNLGNVYCNSLWEGLLHLDD 557

  Fly   785 -------------NTRQRVKPTSQASREDKERWVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIE 836
                         :.....||..:.|...||:::..||..|..:  :.:.|.|:.|.:  .::.|
plant   558 DCVAFCSEDGSALSHASVSKPCPEDSFSVKEKYILGKYLEKALV--IKDESEANLSAA--SRIWE 618

  Fly   837 AVIRADIKSI---------VSILANCPSEVTN---------ANVSARDVRTP------------- 870
            ||...:|:.|         |:|:.....::|:         |..:.:....|             
plant   619 AVQSRNIREIYRLIVTTGDVNIINTKFDDITDIDAYHHIDAAEKAVKKRHDPTVCQRIKESNEPR 683

  Fly   871 --------LLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYARAAQSLATAKSIKAAAAAQA 927
                    |.:||.||:..:.:||:..||::...|:.|||.|.:..::.:...||.:....|   
plant   684 SCLQGCSLLHVACHIGDSVLLELLLQFGADLNIRDYHGRTPLHHCISSGNHKFAKILLRRGA--- 745

  Fly   928 GTTIPAPAPPTNGGI 942
                 .|:...:||:
plant   746 -----RPSIEDDGGL 755

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281 45/234 (19%)
PH 454..>521 CDD:278594 19/66 (29%)
ArfGap 702..818 CDD:279720 55/136 (40%)
ANK <834..907 CDD:238125 24/111 (22%)
ANK repeat 834..866 CDD:293786 9/49 (18%)
Ank_5 859..907 CDD:290568 16/77 (21%)
ANK repeat 868..897 CDD:293786 10/49 (20%)
AGD4NP_001320312.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 114 1.000 Domainoid score I2005
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D751525at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.