DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and AT3G07940

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:NP_187451.2 Gene:AT3G07940 / 819985 AraportID:AT3G07940 Length:385 Species:Arabidopsis thaliana


Alignment Length:242 Identity:70/242 - (28%)
Similarity:111/242 - (45%) Gaps:53/242 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 QATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGL 759
            |.:|:|....|....:.|||.:|.|||:|.|:|.||:|||.:||:||||||:||.|||||.|:.|
plant    40 QTSSSDPRDRLEKLLKQPGNKYCADCGSPEPKWVSLSLGVFICIKCSGVHRSLGVHISKVLSVKL 104

  Fly   760 DDWPSPHLSVMLAI-GNSLANSVWES-NTRQRVKPTSQASREDKERWVRSKYEAKEFLTP----- 817
            |:|....:.:::.. ||:..|..:|: |..|..||...::.|::..::|.|||..:|:.|     
plant   105 DEWTDDQVDMLVGYGGNTAVNERFEACNIDQSKKPKPDSTNEERNDFIRKKYEQHQFMDPKDGAL 169

  Fly   818 -----------------------------------LGNGSSAHPSPSPGQQLIEAVIRADIKSIV 847
                                               .|...|.|..|.....:...|   :...::
plant   170 CTYQQPSRTNTSPPSLCSASHRSTKNRIGHAFRNSWGRRESDHKGPKKSNSMAGMV---EFVGLI 231

  Fly   848 SILANCPSEVTNANVSARDVRT--PLLLACAIGNLAIAQLLIWNGAN 892
            .:     :.|...|::.|||.|  |.:: .|:|..::...:|.|..|
plant   232 KV-----NVVKGTNLAVRDVMTSDPYVI-LALGQQSVKTRVIKNNLN 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 50/157 (32%)
ANK <834..907 CDD:238125 13/61 (21%)
ANK repeat 834..866 CDD:293786 3/31 (10%)
Ank_5 859..907 CDD:290568 11/36 (31%)
ANK repeat 868..897 CDD:293786 7/27 (26%)
AT3G07940NP_187451.2 ArfGap 50..156 CDD:350058 45/105 (43%)
C2_ArfGAP 228..372 CDD:176003 12/51 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.