Sequence 1: | NP_723849.1 | Gene: | CenG1A / 34803 | FlyBaseID: | FBgn0028509 | Length: | 995 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_187451.2 | Gene: | AT3G07940 / 819985 | AraportID: | AT3G07940 | Length: | 385 | Species: | Arabidopsis thaliana |
Alignment Length: | 242 | Identity: | 70/242 - (28%) |
---|---|---|---|
Similarity: | 111/242 - (45%) | Gaps: | 53/242 - (21%) |
- Green bases have known domain annotations that are detailed below.
Fly 695 QATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGL 759
Fly 760 DDWPSPHLSVMLAI-GNSLANSVWES-NTRQRVKPTSQASREDKERWVRSKYEAKEFLTP----- 817
Fly 818 -----------------------------------LGNGSSAHPSPSPGQQLIEAVIRADIKSIV 847
Fly 848 SILANCPSEVTNANVSARDVRT--PLLLACAIGNLAIAQLLIWNGAN 892 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CenG1A | NP_723849.1 | SelP_N | <5..41 | CDD:282453 | |
Centaurin_gamma | 143..300 | CDD:133303 | |||
RAS | 144..295 | CDD:214541 | |||
PH_AGAP | 451..686 | CDD:241281 | |||
PH | 454..>521 | CDD:278594 | |||
ArfGap | 702..818 | CDD:279720 | 50/157 (32%) | ||
ANK | <834..907 | CDD:238125 | 13/61 (21%) | ||
ANK repeat | 834..866 | CDD:293786 | 3/31 (10%) | ||
Ank_5 | 859..907 | CDD:290568 | 11/36 (31%) | ||
ANK repeat | 868..897 | CDD:293786 | 7/27 (26%) | ||
AT3G07940 | NP_187451.2 | ArfGap | 50..156 | CDD:350058 | 45/105 (43%) |
C2_ArfGAP | 228..372 | CDD:176003 | 12/51 (24%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5347 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |