DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CenG1A and arfgap2

DIOPT Version :9

Sequence 1:NP_723849.1 Gene:CenG1A / 34803 FlyBaseID:FBgn0028509 Length:995 Species:Drosophila melanogaster
Sequence 2:XP_005159305.1 Gene:arfgap2 / 641490 ZFINID:ZDB-GENE-051120-177 Length:551 Species:Danio rerio


Alignment Length:288 Identity:65/288 - (22%)
Similarity:104/288 - (36%) Gaps:96/288 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   695 QATSTDLAAMLAIRQRVPGNGFCVDCGAPNPEWASLNLGVLMCIECSGVHRNLGSHISKVRSLGL 759
            :...|::..:....:.:|.|..|.||.|.||.|||::.||.:||:|||:||:||.|:|.:||..|
Zfish     4 EPNKTEIHTIFKRLRSIPTNKACFDCAAKNPSWASISYGVFLCIDCSGIHRSLGVHLSFIRSTEL 68

  Fly   760 D-DWPSPHLSVMLAIGNSLA--------------NSVWESNT----RQRVKPTSQA--SREDKER 803
            | :|....|..|...||:.|              |:.:.|..    |::::..:.|  |:...:.
Zfish    69 DSNWNWFQLRCMQVGGNANAMGFFRQHGCTTNDTNAKYNSRAAQMYREKIRQLANAALSKYGTDL 133

  Fly   804 WVRSKYEAKEFLTPLGNGSSAHPSPSPGQQLIEAVIRADIKSIVSILANCPSEVTNANVSARDVR 868
            |:.|             .|.|.|||                            |........|..
Zfish   134 WIDS-------------SSCAQPSP----------------------------VEKRETDFFDEH 157

  Fly   869 TPLLLACAIGNLAIAQLLIWNGANIKHTDHEGRTCLAYARAAQSLATAKSIKAAAA------AQA 927
            |...::             |:.|:...||..|               |:::....|      ::.
Zfish   158 TQPAIS-------------WDMASPSLTDQNG---------------AENVNPQLAQSNPKNSET 194

  Fly   928 GTTIPAPAPPTNGGIPAPQYNVEDTTAL 955
            ..|.|...|...|...:|:..:||:..|
Zfish   195 PNTQPEEGPSIEGLSTSPKATIEDSMRL 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CenG1ANP_723849.1 SelP_N <5..41 CDD:282453
Centaurin_gamma 143..300 CDD:133303
RAS 144..295 CDD:214541
PH_AGAP 451..686 CDD:241281
PH 454..>521 CDD:278594
ArfGap 702..818 CDD:279720 41/136 (30%)
ANK <834..907 CDD:238125 8/72 (11%)
ANK repeat 834..866 CDD:293786 1/31 (3%)
Ank_5 859..907 CDD:290568 7/47 (15%)
ANK repeat 868..897 CDD:293786 3/28 (11%)
arfgap2XP_005159305.1 PLN03114 1..498 CDD:178661 65/288 (23%)
ArfGap 13..117 CDD:279720 37/103 (36%)
TMF_DNA_bd 270..331 CDD:289127
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5347
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.